KEGG   Histoplasma capsulatum: HCAG_07049Help
Entry
HCAG_07049        CDS       T02229                                 

Definition
(RefSeq) similar to ATP-dependent RNA helicase
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
aje  Histoplasma capsulatum
Brite
KEGG Orthology (KO) [BR:aje00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:aje03041]
    HCAG_07049
   03009 Ribosome biogenesis [BR:aje03009]
    HCAG_07049
Enzymes [BR:aje01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     HCAG_07049
Spliceosome [BR:aje03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    HCAG_07049
Ribosome biogenesis [BR:aje03009]
 Eukaryotic type
  90S particles
   Helicases
    HCAG_07049
  Pre-60S particles
    HCAG_07049
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C DUF4217 DEAD
Motif
Other DBs
NCBI-GeneID: 5444267
NCBI-ProteinID: XP_001537627
UniProt: A6RBP1
AA seq 360 aa AA seqDB search
MAHHSQTYGIVIGGANRRAEAEKLTKGNLKALVIDEADRILEVGFEDEMRQIVKILPAED
RQTMLFSATQTTKVEDLARISLRQGPLYINVDHRKEHSTVEGLEQGYVICDSDKRFLLLF
SFLKRNLKKKIIVFFSSCNCVKYHAELLNYIDLPVLDLHGKQKQQKRTNTFFEFCNATQG
TLICTDVAARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTARGANGKGRSLMFLQPSEVGF
LKHLKEARVPVVEFDFPAKRIVNVQSQLEKLIGQNYYLNKSAKDGYRSYLQAYASHSLRS
VFDVHKLDLVKVAKSFGFPTPPRVDITLAASMSRDKKQQGRRNYGSQPKHAPKFKRKAEA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggctcaccactcccagacatacggtatcgttattggaggagcgaataggagggctgaa
gcggagaagcttacgaaaggcaacctcaaggctcttgtgatagatgaggcagaccggatt
ctcgaagtcggcttcgaagatgaaatgcgccagatcgttaagatcttgccagctgaggat
aggcaaacaatgttattctcggccacgcagacgacaaaggtagaagaccttgcccgtatt
tcgctccggcagggaccgctttatataaatgtcgatcaccgcaaggagcacagcacagtc
gagggcttggaacaaggctatgtcatctgcgattccgacaaacgatttctcctcctcttc
tccttcctgaagcgtaatttgaagaagaagataattgttttcttctccagctgtaactgc
gtcaagtaccatgccgaattattgaactatatcgacctccccgtccttgacctccacggc
aaacagaaacagcagaagcgcacaaatacgtttttcgaattttgcaatgcaactcagggg
acgctgatatgcacggatgttgccgcgagaggcttagatatccccgctgttgattggatc
gttcaattcgatcctcccgatgatccccgggactacattcaccgcgttggccgaacagca
cgtggcgcaaatggcaagggtcgaagcttgatgttcctacagccatctgaagtgggcttc
ctcaaacacctgaaggaggctcgagtccccgtcgtcgagttcgatttcccagctaaaagg
attgtcaacgttcaatctcagctggagaaactcatcggacagaattactatttgaataag
tccgccaaagacggatacagatcctacttgcaagcttacgcctcacactcgctccgctcc
gtctttgatgtccacaaactcgatctcgtcaaagtagccaagagctttggctttccaacc
cctccccgcgtcgacattaccctagccgccagcatgagccgggataaaaagcaacagggt
cgacggaattatggcagtcagcctaaacatgcgccgaagtttaaacggaaggcggaggct
taa

DBGET integrated database retrieval system