KEGG   Histoplasma capsulatum: HCAG_07331Help
Entry
HCAG_07331        CDS       T02229                                 

Definition
(RefSeq) similar to acacb protein
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
aje  Histoplasma capsulatum
Pathway
aje00061  Fatty acid biosynthesis
aje00620  Pyruvate metabolism
aje00640  Propanoate metabolism
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
aje01130  Biosynthesis of antibiotics
aje01212  Fatty acid metabolism
Module
aje_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HCAG_07331
   00640 Propanoate metabolism
    HCAG_07331
  Lipid metabolism
   00061 Fatty acid biosynthesis
    HCAG_07331
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    HCAG_07331
Enzymes [BR:aje01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     HCAG_07331
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     HCAG_07331
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     HCAG_07331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carboxyl_trans ACC_central
Motif
Other DBs
NCBI-GeneID: 5444001
NCBI-ProteinID: XP_001537909
UniProt: A6RCH3
AA seq 1003 aa AA seqDB search
MVTRITQAWMKHNPGYFTFRRPTYDEDESIRHSEPALAFQLELGRLSKFKIKPVFTENRN
IHVYEAIGKGPESDKAVDKRYFTRAVVRPGRLRDDIPTAEYLISEADNLMNDILDALEII
GNNNSDLNHIFINFTPVFPLEPADVERALAGFLERFGRRLWRLRVTGAEIRILCTEPTTG
MAYPLRVVINNTSGYIIQVEMYAERKSEKGEWIFHSIGGTTKIGSMHLRPVSTPYPTKEW
LQPKRYKAHLMGTQYTGIQNYWSKAVEEHSPLADKRPAVGECIDYAELVLDDTDNLIEVV
REPGTNTHGMVGWMITAKTPEYPRGRRFIIIANDITFHIGSFGPQEDKFFHKCTELARKL
GIPRIYLSANSGARIGMAEELMRHFSVAWNDPERPEAGFKYLYLTPEVKKRLDARKTKDV
ITEPVIENGEERHMITTIIGAEDGLGVECLRGSGLIAGATSKAYEDIFTITLVTCRSVGI
GAYLVRLGQRAIQVEGQPIILTGAPAINKLLGREVYTSNLQLGGTQIMYKNGVSHMTAND
DFEGIQKIVQWMSFIPDKKNSPVPIRSYSDTWDRDIGYYPPAKQTYDVRWLIAGKQDDEG
FLPGMFDKDSFQEALGGWARTVVVGRARLGGIPMGVIAVETRSVDTVTPADPANPDSMEL
ISTEAGGVWYLNSAFKTAQALRDFNFGEQLPVMILANWRGFSGGQRDMYNEVLKYGSYIV
DALVKYEQPIFVYIPPFGELRGGSWVVIDPTINPEQMEMYADEESRGGVLEPEGIVNIKY
RRDKQLDTMARLDPEYGELRKALSDKSLPDDQLSKIKAKMTAREEQLLPVYMQIALQFAD
LHDRAGRMEAKGTIRKPLQWRNARRFFYWRLRRRLSEELILKRLAAAAPSTGMRNGAIPT
TGVSASPRPAPPTAREINLNTLKSWTGMLDREFDTNDRKVALWYEENKRKVLEKVEEMRT
ESTAVEVAQLLMGNKDGGLKGVQQVLSMLPMEEREAVLTYLRS
NT seq 3012 nt NT seq  +upstreamnt  +downstreamnt
atggtcactcgcatcacccaagcttggatgaaacataaccccggttacttcacttttagg
aggcctacttacgacgaagatgagagtatccgccacagcgaacccgcgcttgcattccag
cttgaattgggaaggctttccaagttcaaaatcaagcctgtatttacggaaaatagaaat
attcacgtttacgaggcaattgggaaagggccagagagcgacaaggccgtcgataaacga
tatttcacgcgtgctgtggttcgacctgggcgtctgcgggatgacatacccacggcggag
tatcttatttctgaagctgacaacctgatgaatgacatcctcgacgcgctcgaaattatt
ggcaacaataactccgacttgaaccatatcttcatcaactttacgcccgttttcccgctt
gaacccgctgacgttgaaagggcactggcaggcttcctggaacggtttgggcgacggctc
tggcgccttcgcgtgaccggggctgaaattcgcatcctttgcacggagcctacgactggc
atggcctatcccctccgcgtcgtaatcaacaacacctcgggatacattatccaggttgaa
atgtacgctgagcggaaatccgaaaaaggagaatggatattccatagcatcggcggcaca
acgaagattgggtctatgcatcttcgtcccgtatcgacgccctaccccacaaaggaatgg
ctgcagccgaagcgatataaggctcacttgatgggtacccaatatacaggcatccagaac
tactggagcaaggccgttgaggagcactccccacttgccgacaaacgacctgccgtgggc
gagtgcatcgactacgctgaactcgtgctcgacgatactgataacttgatcgaagtagtt
cgcgagcccggaacaaacacacatggaatggttggttggatgatcactgccaaaacccct
gagtacccacgtggtaggcgcttcataatcatcgcgaacgatatcaccttccacattgga
tctttcgggcctcaagaagataaattcttccacaaatgtacggaacttgcgaggaagctg
gggattccgcggatctatctttctgctaactccggtgcacgcattggaatggcagaggag
ctcatgcgtcatttctcagtagcatggaatgatcccgagcggccggaggctggcttcaaa
tacctctatttgacgccggaggtgaagaagagattagacgcgaggaagacaaaggatgtc
ataacggagccagttatagaaaatggtgaagaacgacatatgatcactactatcatcggt
gctgaagatggtcttggtgtcgaatgtctaagaggctctggtctcatcgccggcgctacc
tctaaggcttacgaggatatcttcactattactcttgtgacctgccgttctgttggaatt
ggcgcttacctcgttcgtctgggccaaagagcgattcaagttgaaggacagccaatcatc
ctgactggagctcctgccattaacaaactccttggacgagaagtgtatacgtctaatttg
cagctgggtggaacgcaaataatgtacaagaacggcgtttctcatatgacggccaacgat
gactttgaaggcatacaaaagattgtccaatggatgtcgttcatccccgacaaaaagaat
tctcctgtcccaatcagatcatattcggacacgtgggatcgggatatcgggtattatcct
ccagcgaagcaaacttacgatgtcagatggcttatcgctggtaagcaggatgatgagggt
ttcttacctggcatgttcgacaaggattccttccaggaagcgctcgggggatgggccagg
actgtggttgttggacgtgccaggctcggtggtatccccatgggtgtcatcgcagtcgag
acccggtccgtcgacaccgtcacaccagctgatcctgcgaatccagactcgatggagctg
atttccacggaggctggcggtgtctggtatctgaattcagctttcaaaaccgcacaggct
ctcagggatttcaattttggcgaacagcttcctgtcatgatccttgctaactggcgaggc
ttctctggtggccagcgcgacatgtacaatgaggttctcaagtatggttcctacatcgtc
gatgcccttgtcaaatatgagcagcccattttcgtttacatcccaccatttggggaattg
cgtggtggctcgtgggttgtgattgatcctacgatcaatccagagcagatggagatgtat
gccgatgaggagtctcgcggtggtgtccttgagcctgaaggtattgtcaacatcaagtac
cgccgcgataaacagctggataccatggcccgtttggaccctgaatacggcgaactcaga
aaggccctcagcgacaaatccctgcccgacgaccagctttccaagatcaaagcgaaaatg
accgcaagggaagaacagcttctcccagtctacatgcaaatcgctctgcaatttgccgat
ctccacgatcgcgctggccgcatggaggcgaagggaaccatccgcaaacctctccagtgg
aggaacgccaggcggttcttctattggcgcctgcgccgccgtcttagcgaagagctcatc
ctcaaacgcctggcggccgctgccccatctaccggcatgcgcaacggcgcaatcccaacc
accggcgtctcggcatcccctcggccggctccaccaaccgcccgcgagatcaatctcaat
acgctgaaatcgtggaccgggatgctggaccgggagtttgataccaatgaccgcaaggtt
gcgctctggtatgaagagaacaagcggaaggtgctggagaaggttgaggagatgaggacg
gagagcaccgcagtggaagttgcgcagttgcttatgggaaataaggatggtgggctcaag
ggcgtgcagcaggtgttgagtatgcttcccatggaggaaagggaggctgtgttgacgtat
ttgaggtcttag

DBGET integrated database retrieval system