KEGG   Histoplasma capsulatum: HCAG_07576Help
Entry
HCAG_07576        CDS       T02229                                 

Definition
(RefSeq) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
aje  Histoplasma capsulatum
Pathway
aje00350  Tyrosine metabolism
aje00360  Phenylalanine metabolism
aje00380  Tryptophan metabolism
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aje00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    HCAG_07576
   00360 Phenylalanine metabolism
    HCAG_07576
   00380 Tryptophan metabolism
    HCAG_07576
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    HCAG_07576
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aje04147]
    HCAG_07576
Enzymes [BR:aje01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     HCAG_07576
    4.1.1.105  L-tryptophan decarboxylase
     HCAG_07576
Exosome [BR:aje04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HCAG_07576
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 5443933
NCBI-ProteinID: XP_001537267
UniProt: A6RD68
AA seq 525 aa AA seqDB search
MALIQHFNTISSKPVVPSIEPGYLRPLVPTSAPNHPEPWSKIQPDIESKIMPGLTQWQSP
KFMAYFPAGVTYPSMLGELYSAAFTAPAFNWLCSPACTELEIIVMDWLAQALGLPDCFLS
AAASRSGRSTGGGTIQGSASEAVATVIVAARERHVRAKAMAEGLVEDTPEWEDRTMEMRT
RLVVLGSDQTHSCTAKGARIAGVRYRAIPTRLEENLAMTGDALRRMLEQCERDGLEPFFL
TATMGTTNSCAVDRFAEIKVVLREKEAWKKIWVHIDAAFAGSALVTEEWQHVAKEFAEGV
DSFNVNMAKWLLVNFDASCLFITNALDLTNALDITPAYLRNPSNLTTPVTDFRNWGIPLG
RRFRALKVWFVMRTYGLSGMKAHIRKGINNGVVFADLTRTRDDLFEIVTGPAFGLTTLRV
RGLDETSRTTSTPLSNGATPGQNEKKASQDTSSGVSTQALTHKVCEKINAGGELFLTSSV
LGGVVVIRVVSGNPLAEAKYVRRAFEILVNVTEEVLAEERKKMMN
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcattaatccaacacttcaacaccatctcctccaaaccagtcgttcccagcatagaa
cccgggtacctccgtccactcgttcccacatccgcccccaaccatccagagccatggagc
aagatccaaccggacatcgagtccaaaatcatgccaggcctaacccaatggcagtccccc
aagttcatggcctacttccccgcaggcgtgacatacccctccatgctcggtgagctgtac
tcggcggccttcacggcgcccgcgttcaactggctgtgctcgcccgcgtgcacggagctg
gagatcatcgtcatggactggttggcgcaggcgctcgggctgccagattgcttcctcagc
gctgcggcgtcccggtccggcagaagtaccggcggaggcactatccagggatccgcaagc
gaggctgttgcgaccgttatcgttgccgcgcgcgaaaggcatgtgagggccaaggcaatg
gcggaggggttggtggaggacacgccggagtgggaggatcggacaatggaaatgcggacc
cggcttgtggtgctgggcagcgaccagacgcacagctgcacggcgaaaggggcgcggatt
gctggggtgcggtaccgggctatcccgacgcggttggaagagaatctggccatgacggga
gacgcgttgcgcaggatgctagagcagtgtgaacgcgatggcctggagccgtttttcctg
actgcgacgatgggcacaactaattcatgtgctgttgatcggtttgcggagatcaaggtc
gtgttgagggagaaggaggcgtggaagaaaatatgggtccatatcgatgcggcgtttgct
ggctctgcgctggtgacggaggaatggcagcatgttgcgaaggagttcgcagaaggtgtg
gatagcttcaatgtgaatatggccaaatggctcctagtgaacttcgacgccagttgtctc
ttcatcaccaacgccctcgacctcaccaacgctctggacataacccctgcctacctgcgg
aatcccagcaacctcacgacccccgtaaccgacttccgcaactgggggattcctctcggc
cgacgcttccgcgcgctgaaggtctggttcgtcatgcgcacctacgggctctcgggtatg
aaagctcacatccgcaagggcataaacaacggggttgtcttcgccgacctcaccagaacg
cgagacgacctcttcgagatcgtcacgggccctgcgtttggcttgaccacgttgagagta
cgaggcttggacgagacgtcccgcaccacctctacccccctgagtaatggtgccactccc
gggcagaatgagaagaaagcatcgcaggacacctcttcaggcgtttccacgcaggctctt
acgcacaaagtctgcgagaagatcaatgccggcggcgagttgttcctgacgtcctcggtg
cttggtggggttgtggtgattcgggtggtgagcgggaatccgctggcggaggcgaaatat
gtccgtcgggcattcgagattttagtcaacgttactgaggaggtgttggcagaggagcgc
aagaagatgatgaattaa

DBGET integrated database retrieval system