KEGG   Histoplasma capsulatum: HCAG_07697Help
Entry
HCAG_07697        CDS       T02229                                 

Definition
(RefSeq) succinyl-CoA ligase beta-chain, mitochondrial precursor
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
aje  Histoplasma capsulatum
Pathway
aje00020  Citrate cycle (TCA cycle)
aje00640  Propanoate metabolism
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
aje01130  Biosynthesis of antibiotics
aje01200  Carbon metabolism
Module
aje_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aje_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HCAG_07697
   00640 Propanoate metabolism
    HCAG_07697
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aje04147]
    HCAG_07697
Enzymes [BR:aje01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     HCAG_07697
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HCAG_07697
Exosome [BR:aje04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HCAG_07697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A B2
Motif
Other DBs
NCBI-GeneID: 5443743
NCBI-ProteinID: XP_001537388
UniProt: A6RDI9
AA seq 444 aa AA seqDB search
MFKLVRSNPIAANFRASVRTPIPSRFAQQQRRNLSIHEYLSANLLKTYGVGVPKGEVART
AEEAEAVAKQIDAEDLVIKAQVLAGGRGKGTFDNGLKGGVRVIYSPTEAKMFADQMIGHK
LVTKQTGAQGRICNAVYICERKFARREFYLAILMDRQTQAPVIVSSSQGGVDIETVAKET
PDAITTTSVDINVGVTDEMARNIAKDLGFSEQCLEEAKNTIQKLYKVFMEKDATQIEINP
LCETTEHEVLAMDAKLGFDDNAEFRQKEIFSWRDTTQEDPDEVKAAESGLNFIKLDGDIG
CLVNGAGLAMATMDIIKLNGGNPANFLDVGGGATPQAIRAAFELITSDPKVTAIFVNIFG
GIVRCDAIAQGLINVVNEMNLRTPIVARLQGTNMAKAHELINESGLKIFSMEDLQNAAEK
SVQFSKVVKMARDIDVGVEFSLGI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaactcgtccgtagcaatccaattgctgccaatttcagagcctctgtaaggacg
ccgattcctagtcgctttgcccagcagcaaagaagaaacctctccatccatgaatacctc
tccgcaaacctcctgaaaacatatggggtaggcgttcctaagggcgaagttgcccgaacc
gcagaggaagcagaagctgtagccaaacagattgatgcggaggatctggtgattaaggcc
caggttctcgccggtggccgaggaaagggcacttttgataatggcctgaagggtggtgtg
cgcgttatatattcaccaactgaggccaagatgtttgccgatcagatgatcggccacaag
ctcgtcactaaacaaaccggcgcacaaggtcgcatctgcaatgccgtatatatctgcgag
cgcaaatttgcccgacgagaattctacctagctattctgatggatagacagactcaagca
ccagtcatcgtttcttcatcacaaggtggtgtagatatcgagacagtcgccaaggaaacg
cccgatgccatcaccactaccagtgtcgacattaatgtcggtgtcacagatgagatggca
agaaatattgccaaggacctaggattttcggaacaatgcttggaagaagccaagaatacc
attcaaaagctttacaaagtcttcatggagaaggatgccacacaaatcgagataaaccct
ctttgtgagactactgagcatgaagttcttgccatggatgctaagcttggatttgatgat
aatgccgaatttagacaaaaggaaattttctcatggagagatactacccaggaagacccg
gatgaggtcaaggctgcggaatctggattgaacttcattaaattggacggagatattggg
tgtctggtcaacggcgctggccttgcaatggcaaccatggacattatcaaactcaacggt
ggcaatcccgccaacttcctcgacgttggtggcggcgctaccccacaagctattagagct
gctttcgagctaataaccagtgaccccaaggtcactgccatttttgtcaacattttcggt
ggtatcgttagatgtgatgccatcgctcaaggtttgatcaatgtagttaacgaaatgaat
cttcgcacaccgattgttgcacgtttgcaaggaactaatatggctaaagcgcacgagctg
atcaacgaatcgggcctcaaaatcttttccatggaagatctgcaaaatgcagctgaaaaa
tctgtccagttctccaaagtcgtcaaaatggcccgtgatatcgacgtgggcgtagagttt
tcgcttggtatttaa

DBGET integrated database retrieval system