KEGG   Histoplasma capsulatum: HCAG_08367Help
Entry
HCAG_08367        CDS       T02229                                 

Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
aje  Histoplasma capsulatum
Pathway
aje00010  Glycolysis / Gluconeogenesis
aje00053  Ascorbate and aldarate metabolism
aje00071  Fatty acid degradation
aje00280  Valine, leucine and isoleucine degradation
aje00310  Lysine degradation
aje00330  Arginine and proline metabolism
aje00340  Histidine metabolism
aje00380  Tryptophan metabolism
aje00410  beta-Alanine metabolism
aje00561  Glycerolipid metabolism
aje00620  Pyruvate metabolism
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
aje01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCAG_08367
   00053 Ascorbate and aldarate metabolism
    HCAG_08367
   00620 Pyruvate metabolism
    HCAG_08367
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HCAG_08367
   00561 Glycerolipid metabolism
    HCAG_08367
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HCAG_08367
   00310 Lysine degradation
    HCAG_08367
   00330 Arginine and proline metabolism
    HCAG_08367
   00340 Histidine metabolism
    HCAG_08367
   00380 Tryptophan metabolism
    HCAG_08367
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HCAG_08367
Enzymes [BR:aje01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     HCAG_08367
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 5442992
NCBI-ProteinID: XP_001536585
UniProt: A6RFF1
AA seq 484 aa AA seqDB search
MALSQQITTPTCTYEQPLGLFINNEFVKGVDGRCFETINPHNEKPIAAVHEATEKDVDVA
VAAARAAFNGAWKHVTPTNRGRMLIKLAELMEQHCDVLAAIEALDNGKAYSIAKIDVAQL
CCLHQVIDTDTESFNYTRHEPIGVCGQIIPWNFPLLMFAWKIGPVIATGNTVILKTAEQT
PLSALYTAKLIVEAGFPPGVINILSGFGRTAGAAIAAHMDIDKIAFTGSTAVGRQILQAA
AKSNLKKVTLELGGKSPNIVFNDADIENAISWVNFGIYFNHGQCCCAGSRILVEEGIYDT
FIERFKARAQQNKVGDPFHSDTFQGPQISQVQFDRIMGYIQEGKASGAKVEIGGERLGNQ
GFYIQPTIFSNVTEDMKIVKEEIFGPVCSVQKFKNEEEAIEIANNTSYGLAAAVHTTNLN
TAIRVSNALKAGTVWVNNYNMISYQTPFGGFKESGLGRELGEYALDNYTQIKSVRVRLGD
ALFG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggctctctcccagcaaatcactaccccgacctgcacctacgagcaacccctcggcctc
ttcatcaacaacgagttcgtcaagggcgtcgatggccgctgcttcgagaccattaacccc
cacaacgagaaacccatcgctgccgtccacgaggccaccgagaaggacgtcgatgttgct
gtcgctgctgcccgggccgccttcaacggggcctggaagcatgtcaccccgactaaccgg
ggccgcatgcttatcaagctggcagagctgatggaacagcactgcgacgtcctcgctgcc
atcgaagccctcgacaacggcaaggcctactccatcgccaagatcgatgtcgcccaactc
tgctgcttgcatcaggtcatcgacaccgacacggaatccttcaactacacccgccacgag
cccattggggtctgcggccagatcatcccttggaacttccccttgctcatgttcgcctgg
aaaataggccccgtcatcgccaccggaaacaccgtcatcctcaagaccgcggaacagacc
ccgctctccgctctctataccgccaagctcatcgtcgaggctggtttccctccaggcgtc
atcaacatcctctccggtttcggccgcaccgccggcgctgccatcgccgcccacatggac
attgacaagattgccttcacgggctccaccgcggtcggtcgccagatcctccaggccgct
gccaagagtaacctcaagaaggtcacgctcgaactgggcggcaagagccccaacatcgtc
ttcaacgacgcggatatcgagaacgccatctcttgggtcaactttggtatctacttcaac
cacggccagtgctgctgtgccggcagccgcatcttggtcgaggagggcatctacgacacc
ttcatcgagcgcttcaaggctcgtgcccagcagaacaaggtcggcgacccgttccacagc
gatactttccagggtccccagatctcccaggttcagttcgaccgcatcatgggctatatt
caggaaggcaaggcctccggcgccaaggtcgagattggcggcgagcgcctggggaaccag
ggcttctacatccagccaactattttcagcaacgtcacggaggacatgaagatcgtcaag
gaggagatctttggacccgtctgctccgtgcagaagttcaagaatgaagaggaggctatc
gaaattgccaacaacacgtcatacggtcttgccgctgccgtccacaccacgaacctcaac
accgccatccgtgtctccaacgcactgaaggctggtaccgtctgggtcaacaactacaac
atgatctcttaccaaactcctttcggcggtttcaaggagagcggtctcggccgtgaattg
ggagaatacgcactcgacaattacactcaaatcaaatccgtccgcgttcgcctgggtgat
gcgcttttcggttag

DBGET integrated database retrieval system