KEGG   Histoplasma capsulatum: HCAG_08548Help
Entry
HCAG_08548        CDS       T02229                                 

Definition
(RefSeq) similar to succinyl coenzyme A synthetase
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
aje  Histoplasma capsulatum
Pathway
aje00020  Citrate cycle (TCA cycle)
aje00640  Propanoate metabolism
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
aje01130  Biosynthesis of antibiotics
aje01200  Carbon metabolism
Module
aje_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aje_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HCAG_08548
   00640 Propanoate metabolism
    HCAG_08548
Enzymes [BR:aje01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     HCAG_08548
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HCAG_08548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 5442997
NCBI-ProteinID: XP_001536766
UniProt: A6RFY2
AA seq 138 aa AA seqDB search
MQVFRRNTASVLRNAVLCQRRGLITSTVGYAATADNLRINSDTKVIYQGFTGKQGTFHAQ
QAIDYGTNVVGGTNPKKAGQTHLGKPVFATVRDAVKETGATASAIFVPPPLAAKSIEEAI
ESEVPLVVWFVPHTAFHQ
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgttcaggcgtaataccgcttctgtgttgcgcaatgctgtcctttgccagcgc
cgtggtctcataacctcgactgttggatacgcagccacggcggacaaccttcggatcaac
agcgatacaaaagtcatctaccaagggtttactgggaagcagggaacattccacgcccag
caagccattgactatggaacaaatgtggtcggcggaacaaatcctaaaaaggccggacaa
acgcatcttgggaagccagtattcgccacggtgagggatgctgtgaaagaaactggcgca
accgcatctgccatctttgtccctcctccattagctgccaagagtatcgaagaagcaatt
gaatccgaagttcctcttgttgtttggttcgttccccatacggctttccatcagtag

DBGET integrated database retrieval system