KEGG   Acidipropionibacterium jensenii: C0Z10_00090Help
Entry
C0Z10_00090       CDS       T05836                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
aji  Acidipropionibacterium jensenii
Pathway
aji00051  Fructose and mannose metabolism
aji01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aji00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    C0Z10_00090
Enzymes [BR:aji01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     C0Z10_00090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AZZ38417
UniProt: A0A3Q9UGU1
Position
25689..26840
Genome map
AA seq 383 aa AA seqDB search
MSKKAVHFGAGNIGRGFIGLLEHEAGYEVVFADVSAALIDALNAQSSYVVHEVGDSGHDH
TVTGYRGINSAEHEDDLVHEIATADVVTTAVGPTILRFVAPVINRGIESRDPSAAPLAVM
ACENAINATDVLVGEMKKAAGDWQTIASRAVFANTAVDRIVPAQDPNAGLDVAVEPFFEW
AVEQPPFGEEVPDLPGATFVPSLAPYIERKLFTVNTGHATAAYAGFAAGHHSIAESLADP
AVADLVKRVQAETSTLLSRRHGLDPDDLARYREKILNRFAEPALPDTVERVGRQPLRKLS
GPERFIGPAAALAEAGLPVDALVEAVGKALQFDVPEDPQSVELQKLLADLEPGEFVTQVT
GLGSDHPLFGALTAVVADRQANL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaaggcagttcacttcggagccggaaacatcgggcgcggattcatcggtctg
ctggagcacgaggcgggctacgaggtcgtcttcgccgacgtcagtgcggccctcatcgac
gctctcaacgcgcagtcgagctacgttgttcacgaggtgggggactccggccacgaccac
acggtcaccggctaccgggggatcaacagcgccgagcacgaggacgacctggtccacgag
atcgccacggccgacgtcgtgacgaccgccgtcggcccgacgatcctgcggttcgtggct
ccggtcatcaaccgcggcatcgagtcccgcgatccgtcggcggcaccgttggcggtgatg
gcctgcgagaacgccatcaatgccaccgatgtgctggtcggcgagatgaagaaggcggcc
ggggactggcagaccatcgcgagtcgcgcggtgttcgccaacaccgccgtggaccgcatc
gtcccggcccaggatcccaatgcgggtctggatgtggccgtcgagccgttcttcgagtgg
gccgtggagcagcctccgttcggtgaagaggtcccggatctgcccggtgccaccttcgtc
ccctcgctggccccctacatcgagcgcaagctcttcaccgtcaacacaggccacgcgacg
gccgcctacgcaggtttcgcggcgggtcaccacagcatcgccgagtccctcgcggacccg
gccgtggccgacctcgtcaagcgggtccaggccgagacgtcgacccttctcagccggcgc
cacgggctcgatcccgatgacctggcgcgctaccgggagaagatcctgaaccggttcgcc
gagcccgccctgcccgacaccgtcgagcgggtgggacgtcagccgctgcgcaagctgtcg
ggccccgagcggttcatcggacccgcggcggcactggcggaggccggcctgccggtcgac
gccctcgtcgaggcggtcgggaaggctctccagttcgatgtgcccgaggatccgcagagc
gtcgagctgcagaagctgctggcagatctcgagcccggtgagttcgtcacccaggtcacc
ggccttggctccgaccacccgctgttcggggcgctgaccgcggtcgtcgccgatcgtcag
gccaacctgtaa

DBGET integrated database retrieval system