KEGG   Acidipropionibacterium jensenii: C0Z10_04415Help
Entry
C0Z10_04415       CDS       T05836                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
aji  Acidipropionibacterium jensenii
Pathway
aji00030  Pentose phosphate pathway
aji00480  Glutathione metabolism
aji01100  Metabolic pathways
aji01110  Biosynthesis of secondary metabolites
aji01120  Microbial metabolism in diverse environments
aji01130  Biosynthesis of antibiotics
aji01200  Carbon metabolism
Module
aji_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
aji_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:aji00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C0Z10_04415
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C0Z10_04415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aji04147]
    C0Z10_04415
Enzymes [BR:aji01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     C0Z10_04415
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     C0Z10_04415
Exosome [BR:aji04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   C0Z10_04415
  Exosomal proteins of colorectal cancer cells
   C0Z10_04415
  Exosomal proteins of bladder cancer cells
   C0Z10_04415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AZZ39114
UniProt: A0A3Q9UKA5
Position
complement(978954..980510)
Genome map
AA seq 518 aa AA seqDB search
MSTLETATERTRRRGGNPLRDPLDRRLPRVAGPCVLVLFGVTGDLSRKKLMPAIYDLANR
GLLPPGFGLVGFARRDWEDEDFAQVVHDAVAEHSRTPFREEVWQQLLEGIRFVRGEFDDD
NAFARLADTIRDLDEERGTGGNHAFYLSIPPKSFEKVIGQLKNHGMATQDHSHWNRVVIE
KPFGHDLASARELDALLSGTFSPDAVFRIDHYLGKETVQNVMALRFANQIYEPIWNRNYV
SHVQITMAEDIGIAGRAGYYDGIGAARDVIQNHLLQLLALTAMEEPTNFEAEQLRTEKKK
VLAAVTLPEDLDAHTVRGQYQAGWQGGTWVPGYLDEDGVDPHSTTETYAAIRVGVDNRRW
AGVPFYLRTAKRMPRRVTEVALNFRRAPHLPFHDTQSLGSNALVLRIQPNEGVTLRFGAK
VPGTHNSVRDVTMDFGYGSSFTESSPEAYERLILDVLLGDPPLFPQHEEVELAWRILDPI
LNHWADSPIPPHGYASGTWGPLAGKQMLARDGFEWRRP
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
gtgagcactctcgagacagccaccgagaggactcgtcgacgtggcggcaacccgcttcgc
gacccgctcgaccgccgcctgcccagggtcgccgggccgtgcgtactggtgctcttcggc
gtcaccggtgatctgtcgcgcaagaagctgatgcccgcgatctacgacctggccaaccgc
gggctgctgccgcccggcttcgggctggtcggcttcgcccgccgtgactgggaggacgag
gacttcgcccaggtggtccacgacgccgtcgccgagcactcccggacccccttccgcgag
gaggtctggcagcagctgctggagggcatccggttcgtgcgcggcgagttcgacgacgac
aacgccttcgcccggctggccgacaccatccgcgacctcgacgaggagcgcggcaccggc
ggcaaccacgccttctacctgtcgatcccgccgaagtccttcgagaaggtcatcggccag
ctcaagaaccacggcatggccacccaggaccacagccactggaaccgggtggtcatcgag
aagcccttcggccacgacctggccagcgcccgtgagctggacgccctgctgtcggggacc
ttctcccccgacgcggtctttcggatcgaccattatctgggcaaggagaccgtccagaac
gtcatggcgctgcgcttcgccaaccagatctacgagccgatctggaaccgcaactacgtc
tcccatgtccagatcacgatggccgaggacatcggcatcgccgggagggccgggtactac
gacgggatcggcgcggcgcgcgacgtcatccagaaccacctcctccagctgctggcgctg
accgccatggaggagcccaccaatttcgaggccgagcagctgcgcaccgagaagaaaaag
gtgctggctgcggtcaccctgcccgaggacctggatgcccacaccgtgcgcggccagtac
caggccggctggcagggaggcacctgggtgccggggtatctcgacgaggacggcgtcgac
ccgcactccaccaccgagacctatgcggcgatccgggtcggcgtcgacaaccgccggtgg
gccggtgtgccgttctacctgaggaccgccaagcggatgccccgacgggtcaccgaggtc
gccctgaacttccggcgggccccccacctgcccttccacgacacccagtcgctgggctcc
aacgccctggtgctgcggatccagccgaacgagggggtcaccctgagattcggcgccaag
gtgcccggcacccacaactcggtgcgcgacgtcacgatggacttcggctacggcagctcc
ttcaccgagtccagcccagaggcctacgaacggctcatcctcgacgtcctgctcggcgac
ccgccgctgttcccccagcacgaggaggtcgagctggcctggcggatcctcgacccgatc
ctgaaccactgggcggactcccccatcccgccgcacggatacgcatcgggcacctgggga
cctcttgccggcaagcagatgctggcccgcgacggattcgagtggcgccggccctga

DBGET integrated database retrieval system