KEGG   Acinetobacter junii: BVL33_02125Help
Entry
BVL33_02125       CDS       T04674                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ajn  Acinetobacter junii
Pathway
ajn00480  Glutathione metabolism
ajn00590  Arachidonic acid metabolism
ajn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ajn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BVL33_02125
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BVL33_02125
Enzymes [BR:ajn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BVL33_02125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: APU47407
UniProt: A0A380UC50
Position
437188..437670
Genome map
AA seq 160 aa AA seqDB search
MTTIYDFQAELLEGEQKNLADYQGKVLLVVNTASQCGLTPQFEGLEKLYQDYQQQGLVIL
GFPCNQFANQDPSSNEEIGSFCQRNYGVSFPMFAKVDVNGSNAHPIYKYLTSEAKGILGS
ESIKWNFTKFLINQNGEVIKRYSPTTKPEKIGKDIQKLLA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaatttatgattttcaggctgaacttttagaaggtgagcaaaagaaccttgca
gactatcaaggcaaagttttattggtagtgaacactgcaagtcaatgtggcttaacccca
caatttgaagggcttgagaagctatatcaagactatcaacaacaaggtttggtgatttta
ggttttccatgtaatcagtttgcaaaccaagacccatcaagcaatgaagaaattggcagc
ttctgtcagcgcaactatggtgtgtcatttcctatgtttgccaaagtcgatgtgaatggt
tcaaatgcacatccgatttataaatacctcacctcagaagccaaaggtattttaggtagt
gaaagcatcaaatggaatttcaccaagtttttgattaatcaaaatggcgaagtgattaaa
cgttattctccaacgaccaaacctgaaaaaattggcaaagatattcagaaacttttggct
taa

DBGET integrated database retrieval system