KEGG   Acinetobacter junii: BVL33_09075Help
Entry
BVL33_09075       CDS       T04674                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
ajn  Acinetobacter junii
Pathway
ajn00350  Tyrosine metabolism
ajn00643  Styrene degradation
ajn01100  Metabolic pathways
ajn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ajn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BVL33_09075
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    BVL33_09075
Enzymes [BR:ajn01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     BVL33_09075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: APU48635
Position
complement(1849484..1850116)
Genome map
AA seq 210 aa AA seqDB search
MKLYSYFRSSAAFRVRIALNLKGLSYETEAIHLVKNEQRSAEYQALNPSCLVPTLVDEDQ
AFLQSLSILEYLEERYPDTSLLPKNLIERAKVRAFSQAIASDIHPLNNLRVLKYLQNELD
LNDEQKSHWYKHWILEGFHSLEAQLQASNGKFCFGERPSFADCCLIPQVYNAKRFKVDLT
AFPKIESIYQYCLTLPAFLHAAPEQQADWE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtatagttattttcgtagttcagcagcattcagagttcgtattgcgttgaac
ctaaaaggtttgagctacgagactgaagcgattcatttagttaaaaatgaacaacgtagt
gctgaatatcaagctttaaatccaagctgtcttgtacccacacttgtagacgaggaccaa
gcatttttacagtctttgagtattttggaatatttggaagagcgctatccagatactagc
ttacttccaaaaaacttaattgaacgcgcaaaagttcgtgctttttcacaagccattgca
tcggatattcacccgttaaataacttaagggttttgaaatatttacaaaatgagcttgat
ttaaacgatgaacaaaaaagtcattggtataagcactggattctagagggcttccatagt
ctagaagcacagttgcaagcttccaatggaaagttctgctttggtgagcgtcctagcttt
gcagattgctgcttaataccacaagtttacaatgccaagcgttttaaagttgatcttacg
gcatttccaaaaatcgaatcaatttatcaatattgcctgacactaccagcttttcttcat
gctgcgccagaacaacaagcagattgggaataa

DBGET integrated database retrieval system