KEGG   Acinetobacter junii: BVL33_11705Help
Entry
BVL33_11705       CDS       T04674                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ajn  Acinetobacter junii
Pathway
ajn00071  Fatty acid degradation
ajn00072  Synthesis and degradation of ketone bodies
ajn00280  Valine, leucine and isoleucine degradation
ajn00310  Lysine degradation
ajn00362  Benzoate degradation
ajn00380  Tryptophan metabolism
ajn00620  Pyruvate metabolism
ajn00630  Glyoxylate and dicarboxylate metabolism
ajn00640  Propanoate metabolism
ajn00650  Butanoate metabolism
ajn00900  Terpenoid backbone biosynthesis
ajn01100  Metabolic pathways
ajn01110  Biosynthesis of secondary metabolites
ajn01120  Microbial metabolism in diverse environments
ajn01130  Biosynthesis of antibiotics
ajn01200  Carbon metabolism
ajn01212  Fatty acid metabolism
ajn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ajn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BVL33_11705
   00630 Glyoxylate and dicarboxylate metabolism
    BVL33_11705
   00640 Propanoate metabolism
    BVL33_11705
   00650 Butanoate metabolism
    BVL33_11705
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BVL33_11705
   00072 Synthesis and degradation of ketone bodies
    BVL33_11705
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BVL33_11705
   00310 Lysine degradation
    BVL33_11705
   00380 Tryptophan metabolism
    BVL33_11705
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BVL33_11705
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BVL33_11705
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BVL33_11705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ajn04147]
    BVL33_11705
Enzymes [BR:ajn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BVL33_11705
Exosome [BR:ajn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BVL33_11705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Macoilin
Motif
Other DBs
NCBI-ProteinID: APU49112
Position
2398291..2399817
Genome map
AA seq 508 aa AA seqDB search
MSKTTQENPAVENSAQETVSNTSKATSTPSKSADATPKAASTTTKTTRPRSTSRSTKSTA
SSTSTKAATAKTTKPSVQQDKSMSQNTVRRVAIIGGNRIPFARSNGAYFTASNMDMFTAA
LNGLVGRFNLQGQRLGEVVAGAVLKHSRDFNMTRECVLNTQLAPETPAYDIQQACGTGLQ
AAFLVANKIALGQIEVGIAGGVDTTSDAPIALGDGLRKALLELNIAKTGKDRLKALKKIN
VKDLMDAPKNGEPRTGLSMGDHQAITALEWGISREDQDALAASSHQKMAKAYEEGFFDDL
ITPFLGLSRDNNLRADSTAEKLAKLKPVFGKGEAATMTAGNSTPLTDGASCVLLASEEWA
KANGHEVLAYLTFTETAAVDFVGKKEGLLMAPAYAVPRMLERAGLKLQDFDYYEIHEAFA
SQVLSTLKAWEDEKFCKERLGLDAPLGSIDRSKLNVKGSSLAAGHPFAATGGRIIATAAK
ILNQKGSGRILVSICAAGGQGVTAIIEK
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacaactcaagaaaatccagcagtcgagaattctgctcaagagactgtgtca
aatacatcaaaagcaacttctactccaagtaaaagtgctgacgcaactcctaaagcagca
agtacgacaactaaaacgactcgtcctcgttctaccagtcgtagtacaaaaagcactgct
tcttctacatctacaaaagcagcaacagctaaaacaaccaaaccttctgttcaacaggat
aaaagcatgagccaaaacactgttcgccgtgttgccattattggcggtaaccgtattcca
ttcgctcgttcaaacggcgcatatttcactgcctcaaacatggatatgttcaccgcagca
ttaaacggcttagttgggcgttttaacctacaaggccaacgtttaggtgaagtggttgca
ggtgcggtattaaaacacagccgtgacttcaacatgactcgtgagtgtgttttaaatact
cagcttgcaccagaaactccagcttatgacattcaacaggcatgtggtactggcttacag
gcagctttccttgttgcaaacaaaattgctttgggtcaaatcgaagtgggtattgcaggt
ggtgttgataccacatctgatgcaccgattgcattgggtgacggtttacgtaaagctttg
cttgagctgaacatcgctaaaacaggtaaagaccgccttaaagcattgaaaaaaatcaat
gttaaagatttgatggatgcaccgaaaaatggtgagccacgtacaggtctttcaatgggt
gaccatcaggcaatcactgctcttgagtggggcattagccgtgaagatcaagatgcttta
gcagcttcttctcatcaaaaaatggcaaaagcatacgaagaaggtttcttcgatgactta
atcacgccgttcttaggtttaagccgtgacaacaacttacgtgctgactcaactgctgag
aaattagcaaaattaaaaccagtatttggtaaaggcgaagctgcaacaatgacagcgggt
aactctactccacttactgacggtgcttcatgcgtacttttagcttctgaagaatgggct
aaagcaaacggtcatgaagttcttgcttacctaactttcactgaaactgctgcggttgat
ttcgttggtaaaaaagaaggcttattgatggctcctgcttatgcagttccacgtatgctt
gagcgtgctggccttaaacttcaagacttcgactattacgaaatccatgaagcgtttgca
tcacaagtactttctactttgaaagcttgggaagatgagaagttctgtaaagagcgctta
ggcttagatgcacctttaggttcaattgatcgtagcaaattaaacgttaaaggttcttct
ttagctgcgggtcacccattcgctgcaactggtggtcgtatcatcgcgactgctgcgaaa
atcttaaaccaaaaaggttcaggtcgtatcttagtttcgatctgtgctgctggtggtcaa
ggtgtaacagcaattattgaaaaataa

DBGET integrated database retrieval system