KEGG   Acinetobacter junii: BVL33_14530Help
Entry
BVL33_14530       CDS       T04674                                 

Definition
(GenBank) bifunctional metallophosphatase/5'-nucleotidase
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
ajn  Acinetobacter junii
Pathway
ajn00230  Purine metabolism
ajn00240  Pyrimidine metabolism
ajn00760  Nicotinate and nicotinamide metabolism
ajn01100  Metabolic pathways
ajn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ajn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BVL33_14530
   00240 Pyrimidine metabolism
    BVL33_14530
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BVL33_14530
Enzymes [BR:ajn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     BVL33_14530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos
Motif
Other DBs
NCBI-ProteinID: APU49626
UniProt: A0A3R9GWI2
Position
3019338..3021119
Genome map
AA seq 593 aa AA seqDB search
MTLHPLLKVNALGFIVLALTACNDNDDQNSSATQPERQNQSINILAFNDFHGNLEPPKRF
IEAEDPTDTNKSVRIPVGGVSYFADAINKLRAQYPNNAVVSAGDLISASPLTSSLFLDEP
TIETMNEIKIDFNAVGNHEFDRGTDELRRLQNGGCQQYTTTKPCQINKDFAGAKFNFLAA
NVSLKADPKRTLFPAYKIKRYGNIPVAFIGLTLEATPTIVSAAGIKDVDFHDEAETVNSL
IPELKKQGVEAIVVVVHEGVAPSTKFNAKTCAGLSGPLTGILDRLDTAVDVVVSGHTHQS
YICDYSTLNPQKPFLLTSAGQYGTAITNIKLELDGKTGDVIKKDAQQVPIQSEAYTSGTT
TVNLTNLYEKFNKTPSIEAILDKYRQAVTTISARIVGTATTVINRNAAESGETALGNLIA
DAQQAAALTASNQGSDFTLMNPGGVRADLQTNSNNQITFGDVFAVQPFGNSIVTLSLTGQ
QIRELLEQQWSGANADRPRILQPSKELSYAYKKDATAVPRATQIMISGQALMDSKSYRVT
VNSFIADGGDNFTVLTKGTNRVGGGQDVDALEKYINQNSPVQAPETNRIKVIQ
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgactctacatccattattaaaagtcaacgcgttgggattcatagtattagcactgaca
gcatgtaacgacaacgatgatcaaaatagttctgcaacccaaccagaacgacaaaatcaa
agtattaatattttagctttcaatgattttcacggtaatttggaaccaccgaaacgtttt
attgaggctgaagaccccactgacacgaataaatcggtacgaattcctgtaggtggtgtc
agttatttcgcagatgcaatcaataaactccgtgctcaatatcctaacaatgccgtagta
tctgcgggtgatttaattagtgcctcaccacttacctcatccctattcttggatgaaccg
accattgaaaccatgaatgaaatcaaaattgattttaacgcggttggtaatcatgaattt
gatcgtggaactgatgaattacgtcgtttgcaaaatggtggttgtcagcaatataccacc
actaaaccttgtcaaattaacaaagatttcgctggtgcaaaatttaactttttagcagca
aatgtctctttgaaagctgatcccaaaagaacactatttcctgcatataaaattaagcgc
tatggcaatatccctgttgcgtttattggtttgaccttagaagcaacaccaacaattgtc
tcagcggcaggtatcaaagatgttgattttcatgatgaagccgagactgtcaattcactt
atacctgagttaaaaaagcaaggggttgaagcaattgtcgtagtggtacatgagggtgta
gcgccaagtactaaatttaatgcgaaaacctgcgcaggattaagtggacctttgactgga
atattagatcgtttagatactgcggttgatgtcgtggtttcaggacacacccaccagtct
tatatctgtgactattcaaccttaaacccacaaaagccatttctattgacctcagcagga
caatacggcacagcaattaccaacattaaacttgagctcgatggtaaaactggggatgtc
atcaagaaagatgctcaacaagtaccaattcaaagcgaagcatatacgtctggaacgact
acggttaacttgactaacttatatgagaaatttaacaagacaccaagtatcgaagcgatt
ctggataaatatcgccaagctgtaactacaatttctgcacgtatcgtaggcactgcgacc
acagtcattaatcgaaatgcagctgaaagtggtgaaaccgctttaggtaatttaattgca
gatgcccaacaggcagcagctttaactgcaagcaatcaaggctctgatttcacattaatg
aatccaggtggggtccgtgctgaccttcaaaccaacagtaataatcaaatcacttttgga
gatgtatttgcagtacaaccttttggtaattcgattgtcactttaagtctgacaggccaa
caaatccgtgaacttttagaacaacaatggtctggggcaaatgctgatcgaccgcgcata
ttacagccgtctaaagagctgagttatgcttataaaaaagatgcaactgctgtcccacgt
gcgactcaaattatgatttctgggcaggctttaatggatagcaaatcttatcgagtcacc
gtaaatagttttattgcagatggtggcgataactttactgtactcacaaaaggaaccaat
cgtgtaggtggtggacaagacgttgatgcattagaaaaatacatcaaccaaaattcacct
gttcaagcacctgaaaccaaccgtattaaagttattcagtag

DBGET integrated database retrieval system