KEGG   Acinetobacter johnsonii: RZ95_00650Help
Entry
RZ95_00650        CDS       T04178                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ajo  Acinetobacter johnsonii
Pathway
ajo00480  Glutathione metabolism
ajo00590  Arachidonic acid metabolism
ajo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ajo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    RZ95_00650
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RZ95_00650
Enzymes [BR:ajo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RZ95_00650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ALV74390
UniProt: A0A0U3T9H7
Position
137756..138238
Genome map
AA seq 160 aa AA seqDB search
MTTIYDFQAELLEGEQKNLADYQGKVLLVVNTASQCGLTPQFEGLEKLYQDYQQQGLLIL
GFPCNQFAQQDPASNEEIGSFCQRNYGVSFPMFAKVDVNGPTAHPLYQYLTTEAKGILGS
QSIKWNFTKFLINQKGLVVKRYAPIVKPEKIAKDIQRLLA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaatttatgattttcaggctgaactgttggaaggcgagcaaaaaaatctggca
gattatcagggcaaggttttattggtggtgaataccgccagccaatgtggtttaaccccg
caatttgaaggcttggaaaagttatatcaggactatcaacagcaaggtctactgatttta
ggttttccctgcaaccaatttgcgcagcaagaccctgcgagtaatgaagagatcggcagt
ttttgtcagcgtaattatggggtctctttcccgatgtttgccaaagttgacgtgaatggt
cctacagcgcatccgttgtatcagtatttaaccactgaagctaaaggcattttaggtagt
caaagcatcaagtggaatttcaccaagtttctcattaaccaaaaagggctggtggtgaaa
cgctatgcgccaattgttaagcccgaaaaaattgctaaggatattcaacgccttttggct
taa

DBGET integrated database retrieval system