KEGG   Acinetobacter johnsonii: RZ95_01340Help
Entry
RZ95_01340        CDS       T04178                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
ajo  Acinetobacter johnsonii
Pathway
ajo00020  Citrate cycle (TCA cycle)
ajo00620  Pyruvate metabolism
ajo00650  Butanoate metabolism
ajo01100  Metabolic pathways
ajo01110  Biosynthesis of secondary metabolites
ajo01120  Microbial metabolism in diverse environments
ajo01130  Biosynthesis of antibiotics
ajo01200  Carbon metabolism
Module
ajo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ajo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ajo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RZ95_01340
   00620 Pyruvate metabolism
    RZ95_01340
   00650 Butanoate metabolism
    RZ95_01340
Enzymes [BR:ajo01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     RZ95_01340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans CitF LUD_dom DUF4154
Motif
Other DBs
NCBI-ProteinID: ALV71682
UniProt: A0A0U3RNF9
Position
complement(276282..277799)
Genome map
AA seq 505 aa AA seqDB search
MSLDRIRLASLHDKVISAEEASAFIEDGMTVGMSGFTRAGEAKAVPLALVKRAHTNPLKI
TLITGASLGNDLDKQLTEAGVLARRLPFQVDNTLRKAINNGEVMFIDQHLSETVEQMRNL
QLKKPDVAIIEAVAITEDGGIIPTTSVGNSASFAIFAEKVIVEINTNLSPAFEGLHDIYI
PTYRPTRQPIPLTQVDERIGTHAINIDPAKIVGIVINNDLHDSPSTVTAPDDETQGIADH
LIAFFEKEVAEERLPKNLGPLQAGIGSIANAVLTGLKDSNFEDLVMYSEVLQDCTFELID
AGKMKFASGSSITLSAKYGEKVFNNLEAYKDKLVLRPQEISNHPELVRRLGIIGINTALE
FDIYGNVNSTHVCGTKMMNGIGGSGDFARNAHLAIFVTKSIAKGGDISSIVPFASHIDHA
EHDVDILVTEQGLADLRGLAPRERARAIIDNCAHPLYRDALNDYFDRSCAKGGHTPHLLR
EALSWHSNFEETGHMLPVQAEAKSA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtctttagatcgtatccgtttagcttcacttcacgataaagtcatcagtgcagaagaa
gcgtctgcttttattgaagatggcatgactgtaggtatgagtggcttcactcgtgctggc
gaagcgaaagctgtacctttggcattggttaaacgtgcacacacaaatcctttaaaaatc
acattaattactggtgcttctttaggtaatgacctagacaagcaattgactgaagcgggt
gtattggcacgtcgtttaccgttccaagtggacaacactttacgtaaagccatcaacaat
ggcgaagtgatgttcattgaccaacacttgtctgaaacagttgagcaaatgcgtaacctt
cagttgaaaaaaccagatgtagcaatcattgaagcggttgcaattactgaagatggcggc
atcattccaacaacgtcggtaggtaactctgcaagcttcgcaattttcgcagaaaaagtg
attgttgaaatcaacaccaacttaagccctgcatttgaaggcttacacgatatttacatc
ccaacttaccgtccgacacgtcaaccgattccattgactcaagtggatgagcgtattggt
acgcacgcgatcaatatcgatcctgcaaaaatcgtcggtatcgtcatcaacaatgacttg
cacgactctccatcaactgtgacagcgccagatgatgaaactcaaggcattgcagaccac
ttaatcgcattctttgaaaaagaagtagctgaagagcgtctaccgaaaaacttaggccca
ttacaagcagggattggctcaattgccaatgctgtactcacaggccttaaagattcgaac
ttcgaagacctcgtgatgtactcagaagtgttgcaagactgtactttcgaattgatcgat
gcaggtaaaatgaagtttgcttcaggttcatcaattaccctttctgcaaaatacggcgag
aaagtatttaataaccttgaagcgtacaaagataaattggttttacgtccgcaagaaatt
tcgaaccaccctgaattggttcgtcgtttaggtattatcggcatcaatactgcgcttgaa
tttgatatttacggtaacgtaaactcaactcacgtttgcggtacgaaaatgatgaatggt
atcggtggttcaggtgacttcgcacgtaatgcacaccttgcaatcttcgtaaccaaatca
attgcgaaaggtggcgacatctcttcaatcgtaccgtttgcatcgcacatcgaccatgct
gaacacgatgttgacattcttgtgactgaacaaggtttggctgacctgcgtggtttagca
ccgcgtgaacgtgctcgtgcgattatcgacaactgtgcacacccactgtatcgtgatgca
ttaaacgactacttcgatcgttcatgtgcaaaaggtggtcatacacctcaccttctacgt
gaagcgttgtcttggcattctaactttgaagaaacaggccacatgcttcctgttcaagca
gaagcaaaatctgcttaa

DBGET integrated database retrieval system