KEGG   Acinetobacter johnsonii: RZ95_01840Help
Entry
RZ95_01840        CDS       T04178                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
ajo  Acinetobacter johnsonii
Pathway
ajo00740  Riboflavin metabolism
ajo00790  Folate biosynthesis
ajo01100  Metabolic pathways
ajo01110  Biosynthesis of secondary metabolites
ajo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ajo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    RZ95_01840
   00790 Folate biosynthesis
    RZ95_01840
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RZ95_01840
Enzymes [BR:ajo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     RZ95_01840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2 PRE_C2HC
Motif
Other DBs
NCBI-ProteinID: ALV71770
UniProt: A0A0U3RWU9
Position
complement(380308..380910)
Genome map
AA seq 200 aa AA seqDB search
MPIEFVATSRLPTAFGEFNITVFQDPKTGEEHVALSKGLDQPIIEPVLVRVHSECLTGDA
FASLKCDCGPQLQATQKLINEAGQGVILYLRQEGRGIGLTNKIRAYALQDQGHDTVDANL
MLNLPADARRYDMVSIMLDHLNIQQVRLITNNPLKIAALQEQGINVVDRVPLTVGLNPFN
EEYLKTKHERMAHLYKKDDF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgcctattgaatttgttgccacatcccgtttaccgactgcttttggtgagtttaacatc
accgtatttcaagatcctaagaccggtgaagaacatgttgcactctcaaaaggtttggat
cagccgatcattgaacccgttttagtccgtgttcattccgaatgtctcacgggcgatgcc
tttgcttccttgaagtgtgactgtggcccacaattgcaagccacgcaaaaactgatcaat
gaagctgggcaaggcgtgattctgtatttgcgccaagaaggtcgtggcattgggctcacc
aataaaattcgtgcttatgcgctacaagaccaagggcatgacacggtcgatgccaaccta
atgctcaatctccctgccgatgcacgtcgttatgacatggtcagcattatgttggatcat
ctcaatattcaacaagtccgtttgattaccaacaatccattgaagattgcagcattgcaa
gagcaagggatcaatgtggtagatcgtgtgcctttgacggtcggtttaaatcctttcaat
gaagaatatttaaaaaccaaacatgaacgcatggcacatttgtacaagaaagatgatttt
tga

DBGET integrated database retrieval system