KEGG   Acinetobacter johnsonii: RZ95_03280Help
Entry
RZ95_03280        CDS       T04178                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ajo  Acinetobacter johnsonii
Pathway
ajo00071  Fatty acid degradation
ajo00072  Synthesis and degradation of ketone bodies
ajo00280  Valine, leucine and isoleucine degradation
ajo00310  Lysine degradation
ajo00362  Benzoate degradation
ajo00380  Tryptophan metabolism
ajo00620  Pyruvate metabolism
ajo00630  Glyoxylate and dicarboxylate metabolism
ajo00640  Propanoate metabolism
ajo00650  Butanoate metabolism
ajo00900  Terpenoid backbone biosynthesis
ajo01100  Metabolic pathways
ajo01110  Biosynthesis of secondary metabolites
ajo01120  Microbial metabolism in diverse environments
ajo01130  Biosynthesis of antibiotics
ajo01200  Carbon metabolism
ajo01212  Fatty acid metabolism
ajo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ajo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RZ95_03280
   00630 Glyoxylate and dicarboxylate metabolism
    RZ95_03280
   00640 Propanoate metabolism
    RZ95_03280
   00650 Butanoate metabolism
    RZ95_03280
  Lipid metabolism
   00071 Fatty acid degradation
    RZ95_03280
   00072 Synthesis and degradation of ketone bodies
    RZ95_03280
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RZ95_03280
   00310 Lysine degradation
    RZ95_03280
   00380 Tryptophan metabolism
    RZ95_03280
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RZ95_03280
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RZ95_03280
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RZ95_03280
Enzymes [BR:ajo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RZ95_03280
Exosome [BR:ajo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RZ95_03280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALV72015
UniProt: A0A0U3SS49
Position
complement(655642..656817)
Genome map
AA seq 391 aa AA seqDB search
MTDIVIVNGARTAMGGFQGSLASVTAPELGAVTIKEAIARAGLHANDVEEVIMGCVLPAG
LKQGPARQAMRQAGLPDSTGAVTINKLCGSGMKAVMQAADMIKAGSANIVVAGGMESMTN
APYILTKARAGYRMGHGDVKDHMFLDGLEDAETGRLMGSFAQDMANTRGYTREQMDAFAI
RSLERAQTAVNEGYFADEIVPVTVSSRKGDVVVDKDEQPFNANIAKIPSLRPAFAKDGTI
TAANASSISDGASALVLTSAENASSKGLAPLAKIVAYASNSQHPSEFTIAPVGAIEKVLK
KTGWNAQDVDLWEINEAFAMVTMCPIDDFKLDPAKVNINGGACALGHPVGSTGSRIILTL
IHALKRTGGKKGIAALCIGGGEATAVAIELL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgacagacatcgtaattgtgaatggtgctcgtacagcaatgggcggttttcaaggcagt
ttagccagtgtaaccgctccagagctcggtgctgtaacgattaaagaagcgattgctcgt
gctggcctacacgcaaacgatgtagaagaagtaatcatgggctgtgttctacctgcggga
ttaaagcaaggtccagcacgccaagctatgcgccaagcaggtttacctgattcaacaggt
gctgtgaccatcaataaattatgtggttctggcatgaaagcggtaatgcaagctgcggat
atgatcaaagcaggttcagcaaatatcgtggttgcaggtggcatggagtcgatgaccaat
gctccttatattttaaccaaagcgcgtgcgggctaccgtatggggcatggcgatgttaaa
gaccacatgttccttgatggcttagaagatgcagaaacaggtcgattgatgggttctttt
gcacaagatatggccaatactcgtggctatacgcgtgagcaaatggatgccttcgcgatt
cgctctttagagcgcgcacaaacagcggtcaacgaaggttactttgcagatgaaatcgtg
cctgtgacagtttcatctcgcaaaggtgatgttgtcgttgataaagatgaacaaccgttc
aatgccaatattgcaaaaattccaagccttcgccctgcttttgctaaagatggcaccatc
actgcagcaaatgcaagttcaatctcggatggtgcatccgcactagttttaacttcagca
gaaaatgcatcgagcaaaggtttagcaccattagccaaaattgtggcttatgcatcgaac
tcacaacatccatcagagttcaccattgcaccagtcggtgcaattgaaaaagtgcttaag
aaaacaggttggaatgcacaggacgtagatctttgggaaatcaatgaagcttttgcgatg
gtaactatgtgtccaatcgatgacttcaaacttgatccagcaaaagtgaacatcaatggt
ggagcttgcgcattgggtcaccctgtcggttcaactggttcacgtattatcctgactttg
attcatgcgcttaaacgtacaggtggtaaaaaagggattgcggcactatgcatcggcggt
ggtgaagcgactgctgtagcgattgaattactttaa

DBGET integrated database retrieval system