KEGG   Acinetobacter johnsonii: RZ95_07770Help
Entry
RZ95_07770        CDS       T04178                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ajo  Acinetobacter johnsonii
Pathway
ajo00071  Fatty acid degradation
ajo00072  Synthesis and degradation of ketone bodies
ajo00280  Valine, leucine and isoleucine degradation
ajo00310  Lysine degradation
ajo00362  Benzoate degradation
ajo00380  Tryptophan metabolism
ajo00620  Pyruvate metabolism
ajo00630  Glyoxylate and dicarboxylate metabolism
ajo00640  Propanoate metabolism
ajo00650  Butanoate metabolism
ajo00900  Terpenoid backbone biosynthesis
ajo01100  Metabolic pathways
ajo01110  Biosynthesis of secondary metabolites
ajo01120  Microbial metabolism in diverse environments
ajo01130  Biosynthesis of antibiotics
ajo01200  Carbon metabolism
ajo01212  Fatty acid metabolism
ajo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ajo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RZ95_07770
   00630 Glyoxylate and dicarboxylate metabolism
    RZ95_07770
   00640 Propanoate metabolism
    RZ95_07770
   00650 Butanoate metabolism
    RZ95_07770
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RZ95_07770
   00072 Synthesis and degradation of ketone bodies
    RZ95_07770
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RZ95_07770
   00310 Lysine degradation
    RZ95_07770
   00380 Tryptophan metabolism
    RZ95_07770
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RZ95_07770
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RZ95_07770
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RZ95_07770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ajo04147]
    RZ95_07770
Enzymes [BR:ajo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RZ95_07770
Exosome [BR:ajo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RZ95_07770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALV72806
UniProt: A0A0U3T551
Position
complement(1582010..1583527)
Genome map
AA seq 505 aa AA seqDB search
MSKTTQENPAVENSATETVSNTSKSTPRRTKSTGTTTQSVNNTTKPTRTRAASTRSKSPA
SSTNASKSKTQTAVQQDQTMSQNTVRRVAIIGGNRIPFARSNGAYFTASNTDMFTAALNG
LVERFNLQGQRLGEVVAGAVLKHSRDFNMTRECVLNTALAPETPAYDIQQACGTGLQAAF
LVANKIALGQIEVGVAGGVDTTSDAPIAFGDGLRKALLELNIAKTGKDRLKALTKINLKD
LMDAPKNGEPRTGLSMGDHQAITALEWGIAREAQDELAASSHQKMAAAYEEGFFDDLITP
FLGLERDNNLRADSTVEKLAKLKPAFGKGDARTMTAGNSTPLTDGASCVLLASEEWAKAN
GHEVLAYLTFQETAAVDFVEKKEGLLMAPAYAVPRMLERAGITLQDFDYYEIHEAFASQV
LSTLKAWEDPKFCKDRLGLDAPLGSIDRTKLNVKGSSLAAGHPFAATGGRIIATAAKLIN
QKGSGRVLVSICAAGGQGVTAIIEK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacaactcaagaaaatccagcagtggaaaattctgctacggaaactgtgtca
aatacatcaaaaagtacaccgcgtagaactaaaagtactggcacaacaacccaatcagta
aataacacgactaagccgactcgcacccgtgctgcgtcaactcgtagtaaaagccccgct
tcttctacaaatgcttcaaaatcaaaaactcaaactgctgttcaacaggatcaaaccatg
agtcaaaacactgttcgccgcgtggctattatcggtggtaaccgtattcctttcgctcgc
tcaaatggcgcatatttcaccgcttcgaatacagatatgttcacagcagcgctaaacggt
cttgttgaacgttttaaccttcaaggtcaacgccttggtgaagtggttgctggtgcggta
cttaaacacagccgtgactttaacatgacccgtgaatgtgtactaaacactgcacttgca
ccagaaacacctgcttacgatattcagcaagcatgtggcactggcttacaagcagctttc
ttagttgccaacaaaatcgcactgggccaaattgaagtgggtgttgctggtggtgtagat
acgacttctgatgcaccaattgcgtttggtgatggtttacgtaaagcattgcttgaactc
aacattgcaaaaacaggtaaagaccgtttaaaagctttgactaaaatcaatctaaaagac
ttgatggatgcgccaaaaaatggtgagccacgcacgggtctttctatgggtgatcaccaa
gctattactgcacttgaatggggtattgcacgtgaagcacaagacgaacttgctgcatct
tcacaccaaaaaatggctgcggcttacgaagaaggtttcttcgatgacctgatcacacca
ttcttaggtttagagcgtgacaacaacttacgtgctgactctactgttgaaaaacttgct
aagctcaaaccagcttttggtaaaggcgatgcgcgtaccatgactgcgggtaactcaacc
ccacttacggatggtgcatcttgtgtgcttttagcgtcagaagaatgggccaaagcaaac
ggtcacgaagtacttgcttacttaaccttccaagaaacagctgctgttgatttcgttgag
aaaaaagaaggcttattgatggcgcctgcttatgcagttccacgtatgcttgagcgtgct
ggcattacacttcaagacttcgactactacgaaattcatgaagcatttgcatcgcaagta
ctttctactttgaaagcttgggaagatccaaaattctgtaaagaccgtttaggtttagat
gctccactcggttcaattgaccgcactaaactcaacgtaaaaggttcttcacttgcagca
ggtcacccatttgctgctacgggtggtcgtatcattgctactgctgcgaagttgattaac
caaaaaggttcaggtcgcgtactggtttcaatttgtgctgcaggtggtcaaggtgtaaca
gcgattattgaaaaataa

DBGET integrated database retrieval system