KEGG   Acinetobacter johnsonii: RZ95_09120Help
Entry
RZ95_09120        CDS       T04178                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
ajo  Acinetobacter johnsonii
Pathway
ajo00010  Glycolysis / Gluconeogenesis
ajo00071  Fatty acid degradation
ajo00350  Tyrosine metabolism
ajo00625  Chloroalkane and chloroalkene degradation
ajo00626  Naphthalene degradation
ajo00680  Methane metabolism
ajo01100  Metabolic pathways
ajo01110  Biosynthesis of secondary metabolites
ajo01120  Microbial metabolism in diverse environments
ajo01130  Biosynthesis of antibiotics
ajo01200  Carbon metabolism
ajo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ajo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RZ95_09120
  09102 Energy metabolism
   00680 Methane metabolism
    RZ95_09120
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RZ95_09120
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    RZ95_09120
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RZ95_09120
   00626 Naphthalene degradation
    RZ95_09120
Enzymes [BR:ajo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RZ95_09120
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     RZ95_09120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Met_10 2-Hacid_dh_C TrkA_N MinC_C
Motif
Other DBs
NCBI-ProteinID: ALV73040
UniProt: A0A0U3SPH1
Position
complement(1876390..1877505)
Genome map
AA seq 371 aa AA seqDB search
MKSRAAVAFGPGQPLEIVEIDVAPPQKGEVLVKITHTGVCHTDAFTLSGDDPEGVFPAVL
GHEGAGIVVQVGEGVTSVQPGDHVIPLYTAECGECLFCQSGKTNLCVAVRATQGKGLMPD
GTTRFSYNGQPIYHYMGCSTFSEYTVVAEVSLAKINPDANPEHVCLLGCGVTTGLGAVKN
TAKVQEGDTVAVFGLGGIGLAVVQGAKKAKASRIIAVDTNPDKYKLAAEFGATDFVNPKD
HDRPVQEVIVEMTGWGVDHSFECIGNTNVMRSALECAHRGWGQSVIIGVAGAGQEISTRP
FQLVTGRTWKGTAFGGVKGRSQLPGMVEEAMTGDIRLEPFVTHTMGLDKINEAFDLMHDG
KSIRTVIHFED
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacgtgcagctgttgcctttggacctggacaacctctggaaattgtagaaatt
gatgtcgctccaccacaaaaaggtgaagttttagtcaagattacccatacaggtgtatgc
cataccgacgcatttactttatctggtgatgatcctgaaggtgtttttccagcagtttta
ggccatgaaggtgcgggtatcgtagttcaggtcggtgaaggtgtaaccagcgttcagccg
ggtgatcatgttattccactgtatacggctgagtgtggcgagtgtttattctgccagtca
ggcaagaccaatctatgtgttgcagtccgtgcgacgcagggcaaaggtctgatgccagat
ggtacaacgcgtttttcttataatggacaaccgatatatcactacatgggctgttcaacc
ttttctgaatataccgttgttgcagaagtgtctttggctaaaatcaatccagatgctaac
cctgaacacgtctgcctattgggttgcggcgtgaccactggtttaggtgcagtcaaaaat
acagccaaagtacaagagggtgataccgttgcagtctttggtttaggtggtattggtcta
gcagttgtacaaggtgcaaaaaaagccaaagccagccgtattattgcggttgatacgaac
cctgacaaatataaattagcagcagaattcggagcaactgattttgtaaaccctaaggat
catgaccgtcctgtacaagaagtcattgttgaaatgactggttggggagttgatcactca
tttgaatgtattggtaacactaatgtcatgcgctcagcacttgaatgtgcacaccgtggt
tggggccagtctgtgattattggcgtggcgggtgcaggccaagagatttcaacacgtcca
ttccaactggtcactggccgtacctggaaagggacggcttttggtggtgtaaaaggtcgt
tcacaactgccaggtatggttgaagaagccatgactggtgacattcgtttagagccattt
gttacgcatactatgggtctcgacaaaatcaatgaagcctttgacttaatgcatgatgga
aaatcaatccgtacggtgattcattttgaagactaa

DBGET integrated database retrieval system