KEGG   Acinetobacter johnsonii: RZ95_12635Help
Entry
RZ95_12635        CDS       T04178                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
ajo  Acinetobacter johnsonii
Pathway
ajo00970  Aminoacyl-tRNA biosynthesis
ajo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ajo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RZ95_12635
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ajo03029]
    RZ95_12635
Enzymes [BR:ajo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RZ95_12635
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RZ95_12635
Mitochondrial biogenesis [BR:ajo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RZ95_12635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: ALV73633
UniProt: A0A0U3RIY8
Position
2585294..2585608
Genome map
AA seq 104 aa AA seqDB search
MSTSDAQHSADLNAQTVSAIANLARLSLDDTQSAEYAQSLNKILGMMETLKGIDTDGVEP
LKSPFDHPQPLREDVVSETNHRDEYQAIAPQVQDGLYLVPRVIE
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgtctacatcggatgcacagcattctgcagatttaaatgcacaaacagtttcagcaatc
gccaatcttgctcgattgtcgctagatgatacgcaatctgctgaatatgctcaaagtcta
aataaaattttaggcatgatggaaaccttaaaaggcatcgacaccgatggtgttgagccg
cttaaaagcccatttgatcacccacaacccttacgtgaagatgtggtttcagaaaccaat
catcgtgatgaatatcaagccattgcaccgcaagtgcaagacggtttgtacctagttcct
cgcgtgattgaataa

DBGET integrated database retrieval system