KEGG   Acidovorax sp. JS42: Ajs_0238Help
Entry
Ajs_0238          CDS       T00455                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00970  Aminoacyl-tRNA biosynthesis
ajs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Ajs_0238
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ajs03029]
    Ajs_0238
Enzymes [BR:ajs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Ajs_0238
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Ajs_0238
Mitochondrial biogenesis [BR:ajs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Ajs_0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: ABM40492
UniProt: A1W2L7
Position
complement(254059..254427)
Genome map
AA seq 122 aa AA seqDB search
MNNSPWRSPESRFTYGFRPSLFPMALTPQDIGRIANLARLELSPGESERMLTQLNGFFGI
VEKMQAVDTHGIAPLSHPVAVVRDVQLRLREDVASEPDQREANQRSAPAVERGLFLVPKV
IE
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
gtgaataactccccctggcggagcccggaaagccgctttacatatggtttccgcccgtcc
ctcttccctatggcactgacaccccaggatatcggccgcatcgccaatctggcccggctc
gaactgagccccggcgaaagtgagcgcatgctcacacaactcaacggttttttcggcatc
gtcgagaagatgcaggctgtggatacccatggcatcgcccccctgtcgcacccggtggcg
gtggtgcgggatgtgcagctgcgcctgcgcgaggacgtggccagcgagcccgaccagcgc
gaggccaaccagcgcagcgcgccggccgtcgagcgcggcctgttcctggtgcccaaggtc
atcgagtga

DBGET integrated database retrieval system