KEGG   Acidovorax sp. JS42: Ajs_0500Help
Entry
Ajs_0500          CDS       T00455                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00010  Glycolysis / Gluconeogenesis
ajs00052  Galactose metabolism
ajs00500  Starch and sucrose metabolism
ajs00520  Amino sugar and nucleotide sugar metabolism
ajs00521  Streptomycin biosynthesis
ajs01100  Metabolic pathways
ajs01110  Biosynthesis of secondary metabolites
ajs01120  Microbial metabolism in diverse environments
ajs01130  Biosynthesis of antibiotics
ajs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ajs_0500
   00052 Galactose metabolism
    Ajs_0500
   00500 Starch and sucrose metabolism
    Ajs_0500
   00520 Amino sugar and nucleotide sugar metabolism
    Ajs_0500
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ajs_0500
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Ajs_0500
Enzymes [BR:ajs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ajs_0500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ABM40750
UniProt: A1W3C5
Position
519808..520818
Genome map
AA seq 336 aa AA seqDB search
MMGPMPQQSPTSQSPGLHAGVDIGGTKVAVCLADPANGSGPPVLLTRVAEPTAKTGVPDA
LAQQVLRLLDAACTQQGITRSDLAGVGVASCGPFVRSAGMVEVVNPNICGGLAGAPRGLG
NDWTRVPLQAPLAQALGADRVHVANDAVAALQAERLWGALRGEDDCAYVTWSTGIGVGLC
VDGCVLRGKNGNAGHAGHSYVGDPDAGSDVALCGCGNQGDVESLVAGSALPRRLGREAPA
LMAAADAGDEAALAEVQALCVLMGRLLYNLVATLDLRRISLGGAVFLHHQALLLPLLRAQ
LARYFPALTAGVELVPAGLGGQVGDYAALALLQQPG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatgggccccatgccgcagcaatctcctacctcccagtcgccgggcctgcatgccggc
gtggacattggcggcaccaaagtggccgtgtgcctggcggaccctgccaacggcagcggg
ccgccggtgttgctcacgcgcgtggcggagcccaccgccaagaccggtgtgccggatgcg
ctggcccagcaggtgcttcggctgctggatgccgcctgcacgcagcagggaatcacgcgt
tcggatctggcgggtgtgggcgtggcgtcctgcgggccgttcgtgcggagtgcgggcatg
gtcgaagtggtcaaccccaacatctgcggagggctcgccggtgcgccgcgcggcctgggc
aacgactggacccgggtgccgctgcaggcacccttggcgcaggcgctgggcgcagaccgc
gtgcatgttgccaacgatgccgtggccgcgctgcaggccgagcggctgtggggagcgctg
cggggggaggacgattgcgcctacgtgacctggagtaccggcatcggcgtcggcctgtgc
gtggacggctgcgtgctgcgcggcaagaacggcaacgcgggccatgccggccacagctac
gtgggcgaccccgacgcgggcagcgacgtggcgctgtgcggctgcggcaaccagggcgat
gtggagtcgctcgtcgcgggcagtgcgctgccgcgccgactgggccgggaggcgcccgcg
ctgatggcggcggcggacgcgggtgacgaggccgcgctggccgaagtgcaggcgctgtgc
gtgctgatgggacggctgctgtacaacctggtggccacgttggacctgcggcgcatcagc
ctgggcggtgccgtgttcctgcaccaccaggcgctgctgctgccgctgctgcgtgcgcag
ctggcgcgctacttccccgcgctcaccgccggggtagagctggtgcctgcggggctgggc
ggccaggtgggcgactacgcggcgttggctctgctgcagcagccgggctga

DBGET integrated database retrieval system