KEGG   Acidovorax sp. JS42: Ajs_1249
Entry
Ajs_1249          CDS       T00455                                 
Name
(GenBank) conserved hypothetical protein
Organism
ajs  Acidovorax sp. JS42
SSDB
Motif
Pfam: TraG_N
Other DBs
NCBI-ProteinID: ABM41473
Position
complement(1327178..1328695)
AA seq 505 aa
MTLFTTDYLEYYLTLVSWIVNNGIWAVLVSSGVFALPFVAIIVQEWLKARAEGADEGNKG
VLSAARIENRVFVAIVVVMFAGIPFIDVDLNTIQYDSSRSAQCQVSVPQPTDTGWSQSFS
TINNQSAKVPVWWAFMHALSRAVTSASVAAIPCGTDLRQMRMEIDATRIDDPVLAQEVAD
FSRDCYGPARAKLFMQRPQLDEQQMHDVTWIGSRFFTDTNGYYDTYRSSTPRDDWPYDSN
RDAGLAQVSSGGGYPTCRQWWADGSNGLRARLLGQVDPSLLNRLAGWAGFLSRAEVDDSV
IRTIASPRQQKLNQGSVYTDYGGQIDKTLPNIVTRATGDVGMAVGALAAFPAMDVVRQAL
PMVLALLKMALVICIPLVLVVGTYDLKTVVTVSVVQFALFFTDFWFQLARWIDSTILDAL
YGWGFGWNRPHTNFDPLVGLNNAFGDMLLMFVTGTMFLVLPTFWVAALGWVGVKAGVIAQ
NLAVGSKEARDSAGSGANKVAGKVL
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgacgcttttcacgaccgactacctggagtactacctgacgctggtgtcctggatcgtc
aacaacggcatctgggcggtgctggtatccagcggggtattcgcgctgcctttcgtcgcc
atcatcgtgcaggagtggttgaaggcccgtgcggaaggtgccgacgagggcaataaaggc
gtgctgagcgccgcccgcatcgagaaccgggtcttcgtcgccatcgtggtggtgatgttc
gccggcattccgttcatcgacgtggacctgaacaccatccagtacgacagctcgcgctcg
gcccagtgccaggtcagcgtgccgcagcccacggataccggctggtcgcagtccttcagc
accatcaacaaccagtcggcgaaggtgcccgtctggtgggcgttcatgcatgcactctcg
cgcgccgtcacgagcgcctcggtggcggcgatcccgtgtggcacggacctgcggcagatg
cgcatggagatcgacgccacgcgcatcgatgacccggtgctggctcaggaagtagcggat
ttctcgcgggattgctatgggcctgcacgggccaaattgttcatgcagcgccctcagctc
gatgagcagcagatgcacgacgtgacctggatcggatcgcggttcttcaccgacacgaac
ggctactacgacacgtaccgttccagcacgccgcgcgatgactggccctatgacagcaac
cgcgacgccgggctggctcaggtatccagtggcggtggctacccgacctgcaggcaatgg
tgggctgatggcagcaatggcctgcgggcacgcctgctgggacaggtggacccgagcctg
ctcaatcggctggcgggctgggccgggttcctgagccgggccgaggtggacgactcggtg
atccgcaccatcgcgtcgccgaggcagcagaagttgaaccagggcagcgtctatacggac
tacggcggccagatcgacaagaccttgccgaacatcgtgacgcgggccacgggagacgtt
gggatggcagtcggcgcgcttgcggcatttcccgccatggacgttgtgagacaggccctg
cccatggtgctcgccttgctcaagatggcgctggtcatctgcatcccgctcgtgctggtt
gtgggcacctatgacctgaagacggtcgtcacggtcagcgtcgtgcagttcgcgctgttc
ttcacggacttctggtttcagcttgcgcgctggatcgattcgacgatcctggacgcactt
tatggctgggggttcggctggaaccggccgcacaccaatttcgacccgttggtaggactg
aacaacgccttcggtgacatgctcctgatgttcgtcacgggcacgatgtttctggtcctg
ccgacgttttgggtcgctgccttggggtgggtcggagttaaggctggggtgattgctcag
aaccttgctgtcggctccaaggaagcgcgtgatagcgccgggtcaggtgcaaacaaggta
gccggcaaggttctgtga

DBGET integrated database retrieval system