KEGG   Acidovorax sp. JS42: Ajs_1251
Entry
Ajs_1251          CDS       T00455                                 
Name
(GenBank) conserved hypothetical protein
Organism
ajs  Acidovorax sp. JS42
SSDB
Other DBs
NCBI-ProteinID: ABM41475
Position
complement(1329066..1330460)
AA seq 464 aa
MKRPEPMNLSAKACYLLRPTALAGTLALVCGLAWAQVGYQNSGPVIGDDVMYSIGGGSAV
SMGRAAGMRSIGVGLGWNSNLICGDMSIQTTLRNQLNGITNGFQQIMSNVIQSATSAVAS
LPALIIQRADPGLYNLLTNGVLQARLDFDRSKLTCRAMAEKMAETAGGQLGWSQMAEGMA
LRDAVGSNDAVSAVEQAETRRGNDGVPWVGGSNAGGAGQSAIRVVGDVTRAGYNLVNGRG
VTDTSSIALASCASLSCQTWTSPQQATEWATRVLGEQVQRTCDSCTKTETVPGVGLTPLI
QEEYEAKLEVLQELVSGVRNTTFENLREAGSTSLPITRGVIEALRDEPDQDLLARRLASE
VALSSVLEKALLLQRTLLTGKKEPNVAANELAVEAVNHESDTLDREIRNLKTELELRREL
ANNSPMAIIQRHGTRAAGSRGIYEGDPVPDRLDQLQKGNPGVRP
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgaagcgtcctgaaccgatgaacctttccgccaaggcgtgctacttgctgcgcccgacg
gcgctggccggcacgctcgctctggtctgcggcctggcgtgggcgcaggtcggataccag
aacagcggccccgtcattggcgatgacgtcatgtactcgatcggaggcggcagcgcggtg
tccatgggccgcgcggctggcatgcgctccatcggggtcggcttggggtggaacagcaac
ctgatctgcggcgacatgagcatccagaccacgctgcgcaaccagctcaacggcatcacg
aacggcttccagcagatcatgagcaacgtgatccagagcgccaccagcgcggtggcgtcc
ctgccggcgctgatcattcagcgcgccgatcccggcctgtacaacctgctgaccaacggc
gtgctgcaggcgcggctggacttcgaccgctccaagctgacgtgccgcgcgatggccgag
aagatggccgagacggcgggcggccagcttggctggagccagatggccgaaggcatggcc
ctgcgtgacgcggttggcagcaacgatgccgtttcggccgtcgagcaggctgagacgcgc
cgcggcaacgacggcgttccctgggtgggcggcagcaatgccggtggcgcaggccagtcc
gccattcgggtggtcggcgacgtcacccgcgcgggctacaacctggtcaacgggcgcggc
gtgacggacacatcctccatcgcgctcgccagttgcgcgagcctgtcctgccagacctgg
acgtcgccgcagcaggcgaccgaatgggccacccgggtcctcggggaacaggtgcagcgc
acgtgcgattcctgcaccaagaccgagacggtgcccggcgtcgggctgacgccgctgatc
caggaggagtacgaagccaaactggaagtcttgcaggaactggtttccggcgtgcgcaac
accaccttcgagaacttgcgcgaggccggcagcacgtcgctgccgatcacgcgcggcgtc
atcgaggcgctgcgcgacgagccggaccaggacctgctggcgcggcgccttgcgtccgag
gtggcgctgtcgtcggtgctggagaaggccttgttgctccagcgcacgctgctcacggga
aagaaggagcccaacgtggcggccaacgagttggcggtcgaggctgtgaaccacgagagc
gacacgctcgaccgggagatccgcaacctgaaaacggagctggagctgcgccgcgagctg
gcgaacaactcgccgatggcgatcatccagcgccatggtacgcgcgcggccggctcgcgc
ggcatctacgagggcgatccggtgcccgaccgcctcgaccagttgcagaagggcaatccg
ggagtcaggccatga

DBGET integrated database retrieval system