KEGG   Acidovorax sp. JS42: Ajs_1252
Entry
Ajs_1252          CDS       T00455                                 
Name
(GenBank) protein of unknown function DUF1527
Organism
ajs  Acidovorax sp. JS42
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-ProteinID: ABM41476
Position
complement(1330470..1331417)
AA seq 315 aa
MTRPFDLLRRLRVPVASLLLATATGSYALNTATIVSSVMSPDCLEYRVVGICYWLYCTYG
GCSVRTSVKVRHYVPDAVVSSYSNTGENPWVEVQAMSTPNPSAQAGGDGTTNEDHENDLA
KFKNADVIGHPGGEVFNQFASSSGYFCQGAGTAFMPYLLSTLDTLAWRYNVPEMAYPEAL
IPGMREVGARTTMNLWGNVYPRGGFLHQTDDHKSGAVVAQRAGDVVTRRGQLHVYQPLLA
NARDGYWPAGALVEGDTSTGKWQELTPRLSNTCVVFPHSGTLTQAQQGDYAWALWRPYAC
CERRGQVFLGSVDFL
NT seq 948 nt   +upstreamnt  +downstreamnt
atgacgcgcccattcgatctgctgcgccgcctgcgcgtgcccgtggcctcgctgctgctg
gccaccgccacaggcagctacgccttgaacaccgccacgatcgtctcgtccgtcatgtcg
ccggactgcctggagtaccgggtggtgggcatctgctactggctgtactgcacctatggc
ggctgctcggtgcgcacgtcggtcaaggtcaggcactacgtgcccgatgcggtcgtctcc
agctacagcaacaccggcgagaacccctgggtcgaggtgcaggcgatgagcacgcccaac
ccatccgcccaagcaggcggcgacggaaccacgaacgaagaccacgagaacgacctcgcc
aagttcaagaacgccgacgtgatcggccaccctggcggggaggtgttcaaccagttcgcg
tcgtcctccggctacttctgccaaggcgcgggcacggccttcatgccgtatctgctcagc
accctggacacgctggcctggcgctacaacgtgcccgagatggcctacccggaggcgttg
attccgggcatgcgtgaggtcggtgcgcgcaccacgatgaacctctggggcaatgtctat
ccacgcggtggcttcctgcaccagaccgacgaccacaaatccggggcggtggtggcccag
cgcgcgggcgatgtcgtcacgcgccgcgggcagttgcacgtgtaccagccactgctcgcc
aacgcccgtgacggctactggccggccggggcgctggtcgaaggcgatacctccaccggg
aagtggcaggagctgacccctcgtctgtcgaacacctgcgtggtcttcccccacagcggc
acgctgacccaggcccagcaaggcgactacgcctgggcgctgtggcggccgtatgcctgc
tgcgaacgccgcgggcaggtgttcctgggcagcgtcgatttcctctga

DBGET integrated database retrieval system