KEGG   Acidovorax sp. JS42: Ajs_1253
Entry
Ajs_1253          CDS       T00455                                 
Name
(GenBank) protein of unknown function DUF1525
Organism
ajs  Acidovorax sp. JS42
SSDB
Motif
Pfam: DUF1525 Thioredoxin_3
Other DBs
NCBI-ProteinID: ABM41477
Position
complement(1331414..1331860)
AA seq 148 aa
MPAAFIRFAPSWRTLGLAVALPVSLAVFSPATFAADVVVVTDSRHPVKTMGGERLIELDE
TPRMEAELSANLPADPERAAAIVRQGLNQGGADLQRRIAMAYQGVTDAWSLGVTTIPAVV
VDQRYVVYGEPDVARAIARIKQHRRAQP
NT seq 447 nt   +upstreamnt  +downstreamnt
atgccagcagcttttatccggttcgcaccaagctggcgaacccttggcctggccgtagcg
ctgccggtgtctctggcggtgttcagcccggccaccttcgccgccgacgtggtggtcgtc
accgacagccgccacccggtcaagaccatgggtggcgagcgactgatcgagttggacgaa
acgccccggatggaggccgagctttccgcgaatcttccagccgaccctgagcgggcagca
gccatcgtccggcaaggcctgaaccagggaggcgccgaccttcagcgccgcatcgcgatg
gcctaccaaggcgtgaccgacgcatggagtttgggtgtcacgaccatcccggccgtggtg
gtggaccagcgctatgtggtctatggcgagccggacgtcgcccgcgccatcgcgcgcatc
aagcagcaccggagggcgcagccatga

DBGET integrated database retrieval system