KEGG   Acidovorax sp. JS42: Ajs_1256
Entry
Ajs_1256          CDS       T00455                                 
Name
(GenBank) conserved hypothetical protein
Organism
ajs  Acidovorax sp. JS42
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG FtsK_SpoIIIE AAA_22 TrwB_AAD_bind AAA_10 T2SSE ATPase_2 AAA_7 AAA_16 DUF87 AIG1
Other DBs
NCBI-ProteinID: ABM41480
Position
complement(1333487..1336378)
AA seq 963 aa
MRWKLPWPKLAGAGSSSPASDEQPDSWQRHVEALRQAGIPEPGSAVHGRKPATVADEQAL
YDVAPSFVELLPWVEFMPESKSMLLEDGQSVAAFYELVPLGTEGREPGWLAHARDALENA
LQDSFDELDENPWVLQLYAQDEPSFDQYMQTLRDYVQPRARGSAFTEFYLRFFGHHLRAV
AKPGGLFEDTVVTRLRWRGQTRRVRMVVYRRASGQGQANRRGQTPEQMLGIVCDRLCGGL
ANAGIQARRMVAADVHDWLLRWFNPRPTLLGPGVEDRERFYALARYPDSTEESEAGEIEL
ASGRDFSQRLFFGQPRSDVAQGAWYFDGMPHRVLITDRLRMPPGTGHLTGETRKGDAINT
LFDQMPEDTLMCLTMVATPQDVLEADLNHLAKKAVGETLASEQTLKDVHEARSLIGSAHK
LYRGTLAFYLRGRDEAELDRRGLDLANVMLNAGLQPVREDDEVAPLNSYLRWLPCCYNPG
QDRRRWYTQLMFAQHAANLSPVWGRAQGTGHPGITMFNRGGGPITFDPLNRLDRQMNAHL
FLFGPTGSGKSATLNNLLNQVTAIYRPRLFIVEAGNSFGLFSDFAKRLGLTVNRVKLAPG
SGISLAPFADARRLIETPSDVQTLDADALDEDLPPDASAMEADEQRDVLGELEITARLMI
TGGEDKEEARMTRADRSLIRQCILDAAEHCVAEKRTVLTRDVRNALRTRGQDPTLPEMRR
ARLLEMADAMDMFCQGTDGEMFDRDGTPWPEADITLVDLATYAREGYNAQLSIAYISLIS
TVNNIAERDQYLGRPIVNVTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLATQNIDDL
PRAAEPMLNMIEWWVCLSMPPDEVEKIARFRELSPAQKALMLSARKEAGKFTEGVILSKS
MEVLFRAVPPSLYLALAQTEPEEKAERYQLMQQHGVSELDAAFKVAEKIDRARGIESPTL
DLP
NT seq 2892 nt   +upstreamnt  +downstreamnt
atgcggtggaaactcccatggccgaagctggccggcgccggctccagtagcccggccagc
gatgagcagccggacagctggcagcgccacgtcgaggccttgcgccaggccggcatcccc
gaacccggttcggcagtccacggccgcaagccagcgaccgtggccgacgagcaggcgctg
tacgacgttgcgccgtccttcgtggaactgctgccctgggtggagttcatgcccgagtcg
aaatcgatgctcctggaggacggccaatcggtggcggcgttctacgagctggtgccgctg
ggcaccgaaggccgggaacccggctggctcgcgcatgcccgcgacgccctggaaaacgcg
cttcaggacagtttcgatgaactggacgagaacccgtgggtgctccagctctatgcccag
gacgaaccgagcttcgaccagtacatgcagaccttgcgcgattacgtgcagccacgtgcg
cgcggctcggcgttcaccgagttctacctgcgcttcttcggccaccacctgcgcgctgtg
gccaagcccggcggcctgttcgaggacacggtggtcacgcggctgcgctggcgcggccag
acgcggcgcgtgcgcatggtggtgtaccgccgcgcgagcggacagggacaggcaaaccgc
cgcggccagacacccgagcagatgctgggcatcgtctgcgaccgcctgtgcggcggcctg
gcgaacgccggcatccaggcccggcgcatggtcgcggccgacgtccacgactggctgctg
cggtggttcaacccgcgccccacgctgctcgggcctggggtggaggaccgggagcgcttc
tacgcgttggcgcgctatccggacagtaccgaggaaagcgaggccggcgagatcgagctg
gcgagcgggcgggatttcagccagcggctgttctttgggcagccgcgctcggacgtggcg
caaggggcctggtacttcgacggcatgccgcaccgcgtgctgatcaccgaccggctgcgc
atgccgcccggcaccgggcacctgaccggcgagacccgcaagggggacgcgatcaacacg
ctgttcgaccagatgcccgaggacaccttgatgtgtctcacgatggtcgccacgccgcag
gatgtgctggaagcggacttgaaccacctggcgaagaaggccgtgggcgagacgctggcg
tcggagcagacgctcaaggacgtgcatgaagcccgctccctgatcggcagcgcgcacaag
ctctaccggggcactctggcgttctacctacgcgggcgcgacgaggcggaactggatcgg
cgcggcctggacctcgcgaacgtgatgctcaacgccggcctgcagccggtgcgcgaggac
gacgaggtggcgccgctcaacagctacctgcgctggctgccgtgctgctacaaccccggc
caggatcggcgccggtggtacacgcaactgatgttcgcccagcatgcggcgaacctgtcg
ccggtgtggggccgcgcccagggcacggggcatcccggcatcacgatgttcaatcgcggc
ggcggcccgatcacgttcgatccgctcaaccgcctagaccgacagatgaacgcccacttg
ttcctgttcggccccaccggctccggcaagagcgccacgctcaacaacctattgaatcag
gtcacggccatctaccggccaaggctgttcatcgtggaagccggcaacagcttcggcctg
ttcagcgacttcgccaagcgcctgggcctgaccgtgaaccgggtcaagctggcccccgga
tcgggcatcagcctggcgccgttcgccgacgcacgccggctgatcgaaacgcccagcgac
gtgcagacgctcgatgccgatgcgctggacgaagacctgccaccggatgcctcggccatg
gaggcggatgagcagcgcgacgtgctgggcgaactggagatcacggcacggctgatgatc
acgggcggcgaagacaaggaagaagcgcggatgacgcgggccgaccgctcgctgatccgc
cagtgcatcctcgacgccgccgaacattgcgtggcggagaagcgcaccgtgctcacgcgc
gatgtgcgcaatgcactgcgcacccgtggccaggacccgacgttgcccgagatgcgccgt
gcgcggctgctggagatggcggacgcgatggacatgttctgccaaggcacggacggcgag
atgttcgaccgcgacggcacgccgtggcccgaggccgacatcacgctggtcgatctggcg
acctatgcccgcgagggctacaacgcgcagctctccatcgcctacatcagcctgatcagc
acggtgaacaacatcgccgagcgcgaccagtacctgggacggccgatcgtcaacgtgacc
gacgaaggtcacatcatcaccaagaacccgctgctcgcgccctatgtcgtgaaaattaca
aaaatgtggcgcaagttgggcgcctggttctggctggcgacgcagaacatcgacgacctg
ccacgtgcagcggagccgatgctcaacatgatcgagtggtgggtgtgcctgtcgatgccg
ccggacgaggtggagaagatcgcgcgcttccgcgaactctcgccggcgcagaaggcgctg
atgctctccgcacgcaaggaagcgggcaagttcaccgagggcgtcatcctctccaagagc
atggaagtgctgttccgcgccgtgccgccaagtctctacctcgcgctcgcgcaaaccgag
cccgaggagaaggcagaacgctaccaactcatgcagcagcacggcgtcagcgagctggat
gccgccttcaaggtggctgagaagatcgaccgggcacgtggcatcgagtcgccgaccctg
gacctgccctga

DBGET integrated database retrieval system