KEGG   Acidovorax sp. JS42: Ajs_1257
Entry
Ajs_1257          CDS       T00455                                 
Name
(GenBank) putative secreted protein
Organism
ajs  Acidovorax sp. JS42
SSDB
Other DBs
NCBI-ProteinID: ABM41481
Position
complement(1336378..1336827)
AA seq 149 aa
MHSNLTNLARGLALALAVAVLGGCATSKEKLLTHGDRTMMDIWQQEAGDGGGAAGRNAGR
QLLDARQSLRRPLTDADVQAAPVEQMRYTRTARNEVHRQFQRLPNPDLVMYVYPHLAGTD
PVPVPGYTTVFPLYQRIQYAMPGERVEDY
NT seq 450 nt   +upstreamnt  +downstreamnt
atgcactcgaacttgactaacctggcccgtggcctggcactggccctcgccgtcgcggtg
ctcggcggctgcgccaccagcaaggaaaagctgctgacccacggtgaccgcacgatgatg
gacatctggcagcaggaggccggcgacggcggtggcgcagccggacggaacgccggccgc
cagctgctcgacgcgcgccagagcctgcgtcggcccctgaccgacgccgacgtgcaggcc
gcacctgtcgagcagatgcgctacacgcgcaccgcgcgcaatgaggtccaccgccagttc
cagcgcctgcccaatcccgatctcgtgatgtacgtgtacccgcacctggccggcaccgat
cccgtgccggtgcccggctacacgaccgtcttcccgctctaccagcgcatccagtacgcg
atgccgggcgagcgcgtggaggactactga

DBGET integrated database retrieval system