KEGG   Acidovorax sp. JS42: Ajs_1258
Entry
Ajs_1258          CDS       T00455                                 
Name
(GenBank) putative secreted protein
Organism
ajs  Acidovorax sp. JS42
SSDB
Motif
Pfam: Macoilin Golgin_A5 CC149 Pex19 DUF4407 YabA FUSC UPF0242
Other DBs
NCBI-ProteinID: ABM41482
Position
complement(1336808..1338238)
AA seq 476 aa
MRSNGLLKWLMIPVAILVLFVGIRLFSGGGSTAPPAEDNGAQLTPDEMKALGIEGDTPRD
TVATLVAQVKQLRTELQTALSDNKSQREENQRLRQRENSIDQRINSALESERSNLRRDQE
QAASARQQTEGLLADLQRRLDSIGGRGGGHADLPVGLGLQGGDEAGMEGGVRWVEPDDAK
PAEGRNGGRGASGGMSFPTSFGPAQSTLETTAETVANAGARAAGVKSAKPVYTVPTNSTL
MGSVAMTALIGRVPIDGTVNDPYPFKVLVGPDNLTANGIDIPDVAGAVFSGTASGDWTLS
CVRGQVRSITFVFHDGTIRTIPEDREGNQQDNQQQNSQSGGLGWISDPHGIPCVSGERRS
NAQQYLGSQALITAAGAGVASLIESDSGRMSYVGSDGSIGTVGITGQEAVGQILAGGVRD
MSAWVNKLYGQAFAAVYVQPGAKVAVHLEKPLAIDFDPEGRKVDHRAGKSHALELD
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgcgcagtaacggcctgctcaagtggctgatgatccctgtcgccatcctggtgctgttc
gtcggtatccggctgttctcgggtggaggcagcacggcgccacccgcggaggacaacggc
gcccagctcacgcccgatgaaatgaaggctctcggcatcgagggcgataccccgcgcgac
accgtggcgaccttggtggcgcaggtgaagcagttgcgcaccgagcttcagaccgcgctc
tcggacaacaagtcccagcgtgaagagaaccagcggctgcgtcagcgcgaaaactccatc
gaccagcgcatcaactcggcgctcgaatccgagcggtccaacctgcgccgcgaccaggag
caggcggccagcgcgcgccagcagaccgaagggctgctcgccgacctgcagcggcgcctg
gacagcatcggcgggcgcggcggcggccatgcggacctgcccgtgggcttggggctgcag
ggcggcgacgaggccggcatggagggcggcgtgcggtgggtcgagccggacgacgcaaag
cccgccgaggggcgcaacggggggcgtggcgcgagcggcggcatgagcttccccacgagc
ttcggcccggcgcagagcacgctcgaaaccaccgcggaaaccgtggccaacgcgggcgcc
cgcgccgccggggtcaagagtgccaagccggtctataccgtgccgaccaactcgacgctg
atgggatcggtggcgatgacggccctgatcggccgcgtgccgatcgacggcacggtcaac
gatccctatccgttcaaagtcctggtcgggccggacaacctgaccgccaatggcatcgac
attcccgacgtggccggcgccgtgttcagcggcaccgcctcgggcgactggacgctgtcg
tgcgtgcgcggtcaggtgcgcagcatcacgttcgtcttccacgacggcacgatccgcacg
atccccgaagaccgcgagggcaaccagcaggacaaccaacagcagaactctcaaagtggg
ggcttgggctggatcagcgatccccacggcatcccgtgcgtcagcggcgagcggcgcagc
aacgcccagcaatacctcggctcgcaggccctgatcaccgcggccggtgccggtgtggcc
tcgctcatcgagagcgacagcggccgcatgtcctatgtcggctcggacggctccatcggc
accgtgggcatcaccggccaggaagcggtcggccagattctggcgggcggcgtgcgggac
atgtcggcctgggtcaacaagttgtacggccaggcattcgccgccgtctatgttcagccc
ggcgccaaggtggccgtccacctcgaaaagccgctcgccatcgacttcgatcccgaaggc
cgcaaggtcgatcaccgcgcaggaaaaagccatgcactcgaacttgactaa

DBGET integrated database retrieval system