KEGG   Acidovorax sp. JS42: Ajs_1261
Entry
Ajs_1261          CDS       T00455                                 
Name
(GenBank) conserved hypothetical protein
Organism
ajs  Acidovorax sp. JS42
SSDB
Motif
Pfam: DUF3487 TraL DUF1616
Other DBs
NCBI-ProteinID: ABM41485
Position
complement(1339822..1340220)
AA seq 132 aa
MSEQQHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLLVGAPLSWVFRTI
ALAPTFVVLGVALGVFIGGGILRRLKRGRPDTWLYRQLQWRIVTRHPLMAGWVGGHVLIS
RSGFWSTRRSMR
NT seq 399 nt   +upstreamnt  +downstreamnt
atgtccgagcagcagcacgtccgtgcggacgggaccgtgacgttccttccgcaccggctc
aaccgccatcccgttgtcgtgcgcggcctcaccgccgatgaactctggatttgctgcggc
ctgtccggcgccgccggcctgctggtcggcgcgcccctgtcctgggtgttccgcacgatc
gcgctggcgccgacgttcgtcgtcctgggtgtggcgctcggcgtcttcatcggcggcggc
atcctgcgccgcctcaagcgtgggcgtcccgacacttggctgtatcgacaactgcaatgg
cgcatcgtcacgcgccatccgctgatggcaggctgggttggtggccatgtgctgatctcg
cgctcgggcttctggtccacccgcaggagcatgcgatga

DBGET integrated database retrieval system