KEGG   Acidovorax sp. JS42: Ajs_1264
Entry
Ajs_1264          CDS       T00455                                 
Name
(GenBank) plasmid conserved hypothetical protein, RAQPRD
Organism
ajs  Acidovorax sp. JS42
SSDB
Motif
Pfam: Plasmid_RAQPRD Adeno_PIX
Other DBs
NCBI-ProteinID: ABM41488
Position
complement(1340838..1341221)
AA seq 127 aa
MVASIWLRAAHRGVPTFLVTALLLGLSQMALAESPAQRQKLVAALRQLDALERTVADSAA
HAPIQPGERYHFDYPRLLADLARVRAGIQFHLTPSRAQPRDPSELAGDYRTERAAEPLPA
TTAGGKQ
NT seq 384 nt   +upstreamnt  +downstreamnt
atggtggcttcgatctggctgcgcgccgcgcatcgcggcgtgcccacttttctcgtgacg
gccctcctgctgggtctgtcccagatggccttggccgagtctccggcacagcgccagaag
ctggtcgccgcactgcgccagctcgacgcgctggagcgcaccgtcgcggacagcgccgcg
catgcccccatccagccgggcgagcgctaccacttcgactacccgcggctgctggctgac
ctggcgcgcgttcgcgccggcatccagtttcacctgacgccatcgcgcgctcagccgcgc
gacccctccgaactggccggcgactaccgcaccgagcgggcggccgagccgctgccggcg
acgactgcggggggcaagcaatga

DBGET integrated database retrieval system