KEGG   Acidovorax sp. JS42: Ajs_1273
Entry
Ajs_1273          CDS       T00455                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ajs  Acidovorax sp. JS42
SSDB
Motif
Pfam: DUF4400
Other DBs
NCBI-ProteinID: ABM41497
UniProt: A1W5H2
Position
complement(1348704..1349453)
AA seq 249 aa
MKDAASTAQREQNHRQGLIVGTITLPFRLLGVLIGSLLFSIVVECAGMHLFWKDQGWRHS
QQMLRYELGHLSNHFTRSVVVQEPGRTAHELVDTGYEWVFVRSGLLERMSQTAERVRSAS
HGQSRNFRYYISQVYVWAESYLIAAAFTTLTFLVRLLVLVLTLPLILTAAFVGLIDGLVR
RDVRRFGAGRESGFIYHRAKASLMPLAVLPWVTYLALPISVHPLVILLPSAALLGMAVSL
TAGSFKKYL
NT seq 750 nt   +upstreamnt  +downstreamnt
atgaaggatgccgcctcgaccgcgcagcgggagcagaaccatcgccaaggcttgatcgtc
ggcaccatcaccttaccgttccggctgctcggggtgctcattggctcgctgctgttttcg
atcgtggtggagtgcgccggcatgcacctgttctggaaggaccagggctggcgccactcc
cagcagatgctgcggtacgaactcgggcacctgtccaaccacttcacgcgcagcgtggtg
gtacaggagcccgggcgcacggcgcacgagttggtggataccgggtacgagtgggtgttc
gtgcgctcggggttgctggagcgcatgagccagaccgccgagcgcgtccgctcggccagc
cacgggcagagccgcaacttccgctactacatcagccaagtctatgtctgggccgaaagc
tacctgatcgctgcggccttcacgacgctcaccttcctggtgcgcctgctggtcctggtg
ctcacgctgcccctgatcctcacggcggcattcgtcggcctgattgacggcctggtgcga
cgggatgtgcgccggttcggcgccggccgcgaatccggcttcatctaccaccgcgcgaag
gccagcctgatgccgttggccgtgctgccttgggtcacctatctcgctctgcccatatcg
gtgcatcctctggtcatcctgctgcccagcgcggcgttgctggggatggcagtcagcctg
accgcaggcagcttcaagaagtacttatga

DBGET integrated database retrieval system