KEGG   Acidovorax sp. JS42: Ajs_1274
Entry
Ajs_1274          CDS       T00455                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ajs  Acidovorax sp. JS42
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 TniB AAA_22
Other DBs
NCBI-ProteinID: ABM41498
UniProt: A1W5H3
Position
complement(1349450..1351642)
AA seq 730 aa
MSGKQPVEVLLRPAVELYTVAACAGAAFLSLVAPWSLALSPAMGVGSALAFGAYGAIRYR
DARVILRYRRNIRRLPRYVMTSRDVPVSQQRLFVGRGFLWEQKHTHRLMQTYRPEFRRYA
EPTPAYRLARRLEERLEFAPLPLSRLPKLTGWDVPFNPVRPLPPVGGLPRLHGIEPDEVD
VSLPLGERVGHSLVLGTTRVGKTRLAELFVTQDIRRRNAAGEHEVVIVIDPKGDADLLKR
MYVEAQRAGREGEFYVFHLGWPDISARYNAVGRFGRISEVATRVAGQLSGEGNSAAFREF
AWRFVNIIARALVELGQRPDYMLIQRHVINIDALFIEYAQHYFAKTEPKAWEVIVQIEAK
LNEKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKIAQLLAPNYSDLADPRPIFDWMQVIRKRAVVYVGLDALSDAEVAAAVGNSMFSD
LVSVAGHIYKHGIDDGLPGASAGARVPINVHADEFNELMGDEFIPLINKGGGAGLQVTAY
TQTLSDIEARIGNRAKAGQVIGNFNNLFMLRVRETATAELLTRQLPKVEVYTTTIVSGAT
DSSDIRGATDFTSNTQDRISMSSVPMIEPSHVVGLPKGQCFALLQGGQLWKVRMPLPAPD
PDEVMPADLQQLAGYMRQSYSEATQWWEFTSSSALQDAALPDDLLDDAAAAEPGAVATGA
DDGAGNEAVP
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgtcggggaaacagccagttgaggtactgcttcgcccagcggtggagctatataccgtc
gcggcgtgtgcaggcgccgcgtttctgtccctggtggcaccctggtcgctcgcgctgagc
cccgccatgggcgtcggcagcgcgctggcgttcggggcctacggcgccatccgctaccgc
gatgcccgggtcatcctgcgctaccggcgcaacatccgccgcctgccgcgctacgtgatg
accagcagggacgtgccggtcagccagcagcggctgttcgtggggcgtgggttcttgtgg
gagcagaagcatacccataggctcatgcagacgtaccggccggagttccgccgctacgcc
gagccgacgccggcctaccgcctggccaggcgcctggaggaacggctggaattcgcgcca
ttgccgctctcgcgcctgccgaagctcaccggctgggacgtgcctttcaaccccgtgcgc
ccgttgccgcctgtcggtggcctgccgcgcctgcacggcatcgaacccgacgaggtggat
gtcagcctgccgctgggcgagcgcgtcggccactcgctggtgctgggcaccacgcgggtg
ggcaaaacgcgcctggccgagttgttcgtcacgcaggacatccgccgcaggaatgctgcc
ggcgagcatgaggtcgtcatcgtcatcgatcccaagggggatgccgatctcttgaagcgg
atgtacgtcgaagcccagcgcgctggccgcgaaggcgagttctacgtcttccacttgggc
tggccggacatttcggcacgctacaacgcggtgggccgcttcggccgcatcagcgaagtg
gcgacccgggtggcggggcagctctccggcgaaggcaacagcgcggcgttccgcgagttc
gcatggcgcttcgtgaacatcatcgcccgcgccctggtggaactggggcagcgcccggac
tacatgctgatccagcgccacgtcatcaacatcgacgcgctgttcatcgagtacgcccag
cactacttcgccaagacggagcccaaggcctgggaggtgatcgtccagatcgaggccaag
ctcaacgagaagaacatcccgcgcaacatgatcgggcgcgagaagcgcgtggtggcgctg
gagcagtacctctcgcaggcgcgcaactacgacccggtgctggatggcctgcgctcggcg
gttcgctacgacaagacctacttcgacaagatcgttgcatcgcttctgccgctgctggaa
aagctcaccagcggcaagatcgcccagctcctggcgccgaactactccgacctggccgac
ccacggccgatcttcgactggatgcaggtgatcaggaagcgagccgtcgtctatgtgggc
ctggatgcgctgtccgatgccgaggtcgccgcggcggtcggcaattcgatgttctccgac
ctggtttcggtcgcaggccacatctacaagcacgggatcgacgatggactgccgggtgca
tcggctggtgcgcgcgtgccgatcaacgtgcatgcggacgagttcaatgaattgatgggt
gacgagttcattccgctcatcaacaagggcggtggcgcgggcctgcaagtcaccgcctac
acgcaaacgctctcggacatcgaggcccgcatcggcaatcgcgcgaaggccggccaagtg
atcgggaatttcaacaacctgttcatgttgcgcgtgcgcgagacggccaccgcggaactg
ctgacgaggcagttgccgaaggtcgaggtctatacgactaccatcgtctcgggcgcgacg
gacagctcagacatccgcggcgcgacggatttcacgtcgaacacccaggaccgcatcagc
atgtccagcgtgccgatgatcgagccgtcacacgtcgtcggcctgcccaagggccagtgc
ttcgcgctgctgcagggcggccagctctggaaggtgcgtatgccgctgccggcgccggac
ccggatgaagtgatgccggcggacctgcagcaactggccgggtacatgcgccagagctac
agcgaggccacgcagtggtgggagttcaccagctcgtcggccttgcaggatgcggccttg
cccgacgacctgctggacgatgccgctgcggccgagcccggcgcggtggccaccggcgcc
gacgatggcgcgggcaacgaggccgtgccatga

DBGET integrated database retrieval system