KEGG   Acidovorax sp. JS42: Ajs_1277Help
Entry
Ajs_1277          CDS       T00455                                 

Definition
(GenBank) putative secreted protein
Organism
ajs  Acidovorax sp. JS42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ABM41501
UniProt: A1W5H6
Position
complement(1352764..1353489)
Genome map
AA seq 241 aa AA seqDB search
MKPSILLTLFLLAAAQLPVWAQQPATAQSRNAQSQERPVIGRILDDRVASDWGLQPQEWA
RYRELMEGPLGIYSPNLDPLSALGVEARSDEERRRYAEMQVKAEARRVEKLLAYQRAYDE
AWQRLNPGMQRVNLPDDLPTAAGVRGSSRTAVFVKDGCAACGQLVQRLQSSGAEFDLYMV
GSRQDDARIRDWAKRANVDPARVRAGSITLNHDGGRWLSLGLPGDLPAAVREVNGQWQRQ
P
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaagccctcgatcttgctcaccctgttcctgctggccgcagcgcagttgcccgtctgg
gcgcagcagcccgccacggcccagtcccgcaatgcccagagccaggagcgtcccgtgatc
ggccgcatcctggacgaccgcgtggcgagcgactggggactgcaaccgcaggagtgggcg
cgctaccgcgaactgatggaggggccgctgggcatctactcgcccaacctggacccgctt
tccgcgctgggcgtcgaggctcgctccgatgaagagcggcgccgctacgccgaaatgcag
gtgaaagccgaggcaaggcgcgtcgagaagttgcttgcctaccagcgcgcctacgacgaa
gcgtggcagcgcctgaaccccggcatgcagcgagtgaacctccccgatgatctgccgacc
gccgcaggcgtgcgcggcagtagccgcacggcggtgttcgtgaaggacggctgcgcggcc
tgcgggcaactcgtgcagcgcctgcaatcctcgggcgccgagttcgacctctacatggtc
ggcagccgccaggacgatgcgcgcatccgcgactgggccaagcgcgcgaacgtcgatccg
gcgcgcgtgcgcgccggcagcatcacgctcaaccacgacggcggccgctggctgtcgctg
ggcctgcccggcgatctgcccgccgccgtgcgcgaagtgaatggccaatggcagcgccag
ccgtag

DBGET integrated database retrieval system