KEGG   Acidovorax sp. JS42: Ajs_1279
Entry
Ajs_1279          CDS       T00455                                 
Name
(GenBank) putative secreted protein
Organism
ajs  Acidovorax sp. JS42
SSDB
Other DBs
NCBI-ProteinID: ABM41503
Position
complement(1354138..1354704)
AA seq 188 aa
MPAIHVSRHLVGAGLLAAALASGCATTTAPLAPDAIEEVSAAPEPEAPEYIPVVRYGRYT
LVELAPTAAQRDLLLQTIDVSMPEDARATVGDGLRHVLKRSGYGLCETAHAVIELYALPL
PAAHLHLGPMTLRDALLTLAGPAWDLHADDRTRQVCFERHGRDADADPVPEPLATEAVQT
FPLAGGQP
NT seq 567 nt   +upstreamnt  +downstreamnt
atgcccgcaatccatgtatcccggcacctggtcggcgccggcctcctggccgcagccttg
gccagcggctgcgcgaccaccacggcgccgctcgcacccgatgccatcgaggaagtctcg
gccgcgcccgaacccgaggcgcccgagtacatcccggtcgtgcgctacggccgctacacc
ctggtcgagttggcacccacggcggcgcagcgcgacctgctgttgcagaccatcgacgtg
tccatgcccgaggatgcccgcgccacggttggcgacgggctgcggcatgtgctcaagcgc
agcggctatggcctttgcgagaccgcgcatgccgtgatcgagctgtacgcgctgccgttg
cctgcggcacatctgcacctcggccctatgaccttgcgcgatgcgctactcacccttgcc
ggcccggcctgggacctgcacgccgatgaccggacgcgacaggtctgcttcgagcggcac
ggccgcgatgcagatgccgatccggttcccgaaccactcgccaccgaggcggtgcagacg
ttcccgctcgcgggaggtcagccatga

DBGET integrated database retrieval system