KEGG   Acidovorax sp. JS42: Ajs_1391Help
Entry
Ajs_1391          CDS       T00455                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ajs  Acidovorax sp. JS42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraG_N
Motif
Other DBs
NCBI-ProteinID: ABM41606
UniProt: A1W5T1
Position
complement(1458383..1459906)
Genome map
AA seq 507 aa AA seqDB search
MTLFTTDYLEYYLTLVSWIVNNGIWAVLVSSGVFALPFVAIVVQEWLKARAEGADEGNKG
VLSAARIENRVFVAIVVVMFAGIPFIDVDLNTIQYDSSRSAQCQVSVPQPAETGWSQSFS
TINNQSAKVPVWWAFMHALSRAVTSASVAAIPCGTDLRQMRMEIDATRIDDPVLAQEVAD
FSRDCYGPARAKLFMQRPQLDEQQMHDVTWIGSRFFTDTGGYYDSYRSSTAREAWPYDDT
RDAGLAQVANGGGYPTCRQWWSDGSNGLRARLLGQVDPSLLNRLAGWAGFLSRAEVDDSV
IRAIASPRQQKLNQGSVYTDYGGQIDKSLPNIVTRAAGDVGMTVGAIAAFPAMDVVRQAV
PMVLALLKMALVICIPLVLLVGTYDLKTVVTVSVVQFALFFTDFWFQLARWIDSTILDAL
YGWGFGWNRPHTNFDPLVGLNNAFGDMLMMFVMGTMFIVLPTFWIMALAWAGVRAGNVLQ
GLAGATADAKAAGGKGGSIAINAVAKK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttttcacgaccgactacctggagtactacctcaccctcgtgtcctggatcgtc
aacaacggcatctgggccgtactggtgtccagcggtgtgttcgcgctgccgttcgtcgcc
atcgtcgtgcaggaatggctgaaggcccgcgcagaaggcgctgacgaaggtaacaagggt
gtgctctcggccgcgcgcatcgagaaccgggtcttcgtcgccatcgtggtggtgatgttc
gccggcattccgttcatcgacgtggacctgaacaccatccagtacgacagctcgcgctcg
gcccagtgccaggtcagcgtgccgcagcccgcggagaccggctggtcgcagtctttcagc
accatcaacaaccagtcggcgaaggtgccggtctggtgggccttcatgcacgcgctttcg
cgtgccgtcacgagcgcctcggtggctgcgatcccgtgcggcactgacctgcggcagatg
cggatggagatcgacgcgacccgtatcgacgacccggtgctggcccaggaagtagcggat
ttctcgcgggattgctatgggcctgcacgggccaaattgttcatgcagcgccctcagctc
gatgagcagcagatgcacgacgtgacctggatcggatcgcggttcttcacggacacgggt
ggctactacgacagttaccgctccagcacggcgcgcgaagcatggccctatgacgacacc
cgcgatgcggggctcgcgcaggtagccaatggcggcggctacccgacttgcaggcagtgg
tggtcagacggcagcaacggcctgcgcgcgcggctgctggggcaagtggacccgagcctg
ctgaatcgcctggcgggctgggccgggttcctgagccgggccgaggtggacgattcggtg
atccgcgccatcgcgtcaccgcggcagcagaaattgaaccagggcagcgtctatacggac
tacggcggtcagatcgacaagtccttaccgaacatcgtcacccgtgccgcgggcgatgtg
gggatgacagtcggggcgatcgccgcattccccgccatggatgtagtacgccaggccgta
ccgatggtgctcgccctgctcaagatggcgctggtcatctgcatcccgctcgtgctgctc
gtgggcacctacgacctcaagacagtcgttaccgtcagcgtcgtgcagttcgcgctgttc
ttcacggatttctggttccaactcgcccgctggatcgacagcaccatcctcgatgcgctc
tatgggtggggcttcgggtggaaccggccgcataccaacttcgatccgctggtggggctg
aacaacgccttcggcgacatgctcatgatgttcgtcatgggcacgatgttcatcgtgctg
cctacgttctggatcatggcgctggcttgggcgggcgttcgcgccggcaacgtcctgcaa
ggcctcgccggggcgaccgctgatgccaaggccgccggcgggaaaggcggaagtatcgcg
atcaatgcagtggcgaagaagtga

DBGET integrated database retrieval system