KEGG   Acidovorax sp. JS42: Ajs_1393Help
Entry
Ajs_1393          CDS       T00455                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ajs  Acidovorax sp. JS42
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABM41608
UniProt: A1W5T3
Position
complement(1460289..1461686)
Genome map
AA seq 465 aa AA seqDB search
MKIRTALNPLSRQARHTKIVLALAGTLALASGVAWGQLGYQTSGSVIGDDVMYSIGGGSA
VSMGRAAGMRSLGVGVGWNSNLICGDMSIQTTLKNQLNGITNGFQQIMSSVIQSATSAVA
SLPALIIQRADPGLYNLLTNGVLQARLDFDRSKLTCRAMAEKMADTAGGQLGWSQMAEGL
ALRDAVSSTDAVSAIEQAETRRGNDGVPWIGGSNAGGSGQPAIKVVGDVTRAGYNLVNGR
GVTDTSSIAPSSCSSLSCQTWASPQAAVEWATRVLGEKEQRTCDACTKTETTPGVGLTPL
IQEEYDAKLQALQGLVSKAKNTTPENLREAGSASLPITRGVIEALRDEPDQHLLSQRLAS
EVALSSVLEKALLLQRTLLTGKKEPNVAANELAVDAVNKESDTLDREIRNLKTELELRRE
LANNSPMAIIQRHGARATGSRGIYEGDPVPDRLDQLQKGNPGSQP
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcgtaccgcactcaatccgctctcccgccaggcacgccacacgaagatcgtc
ctggcgctggccggcacgctcgcgctggccagcggcgtggcctggggccaactgggctac
cagaccagcggcagcgtcatcggcgatgacgtcatgtactcgatcggcggcggcagtgcc
gtgtcgatgggacgcgcggccggcatgcgctccctcggggtgggcgtgggctggaacagc
aacttgatctgcggcgacatgagcatccagaccacgttgaagaaccagctcaacggcatc
accaacggcttccagcaaatcatgtcgtcagtgatccagagcgccaccagcgcggtggcg
tctttgcctgcgctgatcatccagcgcgccgatcccggcctctacaacctgcttaccaat
ggcgtgctgcaggcacgtctcgatttcgaccgctccaagctgacgtgccgtgccatggcc
gagaagatggccgacacggcaggcggccagctcggctggagccagatggccgaaggcttg
gcgctgcgcgatgctgtgtcgagtacggatgcggtctcggccatcgagcaggccgagacg
cgccgcggcaatgacggcgtgccgtggatcgggggcagcaacgcgggcggctccggtcag
cccgcaatcaaggtcgtcggcgatgtcacccgcgccggctacaacctggtcaacggccgc
ggcgtgaccgatacgtcgtccatcgcgccgtccagttgcagcagcctctcgtgccagacc
tgggcctcgccgcaggcggccgtcgagtgggccacgcgcgtgctcggcgagaaggaacaa
cgcacttgcgatgcctgcacaaagaccgagacgacgcccggcgtcgggctgacgccgctg
atccaggaagagtacgacgcgaagctgcaggcgctccagggtctcgtctccaaggcgaag
aacacgacgccggagaacctgcgcgaggccggcagtgcatcgctgccgatcacgcgcggc
gtgatcgaagcactgcgcgacgagcccgaccagcatctgctgtcgcagcgcctggcgtcc
gaggtcgcgctgtcgtccgtgctggagaaagcgctgctgctgcagcgcacgctgctcacg
gggaagaaggagcccaacgtcgcggccaacgagcttgcggtggatgccgtaaacaaggag
agcgacacactcgaccgcgaaatccgcaacctcaagacggaactggagctgcggcgcgag
ctggcgaacaattcgcccatggcgatcatccagcgccacggcgcgcgcgcgactggctcg
cgcggcatctacgagggcgacccggtgcctgatcgtctcgaccagctccagaagggcaat
ccggggagtcagccatga

DBGET integrated database retrieval system