KEGG   Acidovorax sp. JS42: Ajs_1394Help
Entry
Ajs_1394          CDS       T00455                                 

Definition
(GenBank) protein of unknown function DUF1527
Organism
ajs  Acidovorax sp. JS42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraU
Motif
Other DBs
NCBI-ProteinID: ABM41609
UniProt: A1W5T4
Position
complement(1461696..1462643)
Genome map
AA seq 315 aa AA seqDB search
MTRPFDLLRRLRVPVASLLLATATGSYALNTATIVSSVMSPDCLEYRVVGICYWLYCTYG
GCSVRTSVKVRHYVPDAVVSSYSNTGENPWVEVQAMSTPNPSAQAGGDGTTNEDHENDLA
KFKNADVIGHPGVEVFNQFVSSSGYFCEGAGTAFMPYLLSTLDTLAWRYNVPEMAYPEAL
VPGMREVGARTTMNLWGNVYPRGGFLHQTDDHKAGAVVAQRAGDVVTRRGQIHVYQPLLA
DSRPGYWPAGALVEGDASTGKWQELTPVLSSSCTVFPRNDFLTQAQQGDYAWALWRPYAC
CERKGQVFLGSVDFN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcccattcgatctgctgcgccgcctgcgcgtgcccgtggcctcgctgctgctg
gccaccgccacaggcagctacgccttgaacaccgccacgatcgtctcgtccgtcatgtcg
ccggactgcctggagtaccgggtggtgggcatctgctactggctgtactgcacctatggc
ggctgctcggtgcgcacgtcggtcaaggtcaggcactacgtgcccgatgcggtcgtctcc
agctacagcaacaccggcgagaacccctgggtcgaggtgcaggcgatgagcacgcccaac
ccatccgcccaagcaggcggcgacggaaccacgaacgaagaccacgagaacgacctcgcc
aagttcaagaacgccgacgtgatcggccaccctggcgtcgaggtgttcaaccagttcgtc
tcgtcgtcgggctacttctgcgagggcgcgggtacggcgttcatgccgtacttgctcagc
acgctggatacgctggcctggcgctacaacgtgcccgagatggcctacccggaagcgctg
gttccaggcatgcgcgaggtcggcgcacgcaccacgatgaacctctggggcaacgtgtat
ccccgtggcggcttcctgcaccagaccgacgaccacaaagctggtgccgtggtggcccaa
cgtgcaggtgatgttgtcacgcgccgcgggcagatccacgtctatcagccgctgctcgcc
gattcgcggcccggctactggcctgccggcgcgctggtggagggcgacgcatcgaccggg
aagtggcaggaactcacgcccgttctgtcctcgtcctgcacggttttcccgcgtaacgat
ttcctgacccaggcccagcaaggcgactacgcctgggcattgtggcggccctatgcctgc
tgcgaacgcaagggccaggtcttcctcggcagcgtcgatttcaactga

DBGET integrated database retrieval system