KEGG   Acidovorax sp. JS42: Ajs_1395Help
Entry
Ajs_1395          CDS       T00455                                 

Definition
(GenBank) protein of unknown function DUF1525
Organism
ajs  Acidovorax sp. JS42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1525 Thioredoxin_3
Motif
Other DBs
NCBI-ProteinID: ABM41610
UniProt: A1W5F2
Position
complement(1462640..1463086)
Genome map
AA seq 148 aa AA seqDB search
MPAAFIRFAPSWRTLGLAVALPVSLAVFSPATFAADVVVVTDSRHPVKTMGGERLIELDE
TPRMEAELSANLPADPERAAAIVRQGLNQGGADLQRRIAMAYQGVTDAWSLGVTTIPAVV
VDQRYVVYGEPDVARAIARIKQHRRAQP
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgccagcagcttttatccggttcgcaccaagctggcgaacccttggcctggccgtagcg
ctgccggtgtctctggcggtgttcagcccggccaccttcgccgccgacgtggtggtcgtc
accgacagccgccacccggtcaagaccatgggtggcgagcgactgatcgagttggacgaa
acgccccggatggaggccgagctttccgcgaatcttccagccgaccctgagcgggcagca
gccatcgtccggcaaggcctgaaccagggaggcgccgaccttcagcgccgcatcgcgatg
gcctaccaaggcgtgaccgacgcatggagtttgggtgtcacgaccatcccggccgtggtg
gtggaccagcgctatgtggtctatggcgagccggacgtcgcccgcgccatcgcgcgcatc
aagcagcaccggagggcgcagccatga

DBGET integrated database retrieval system