KEGG   Acidovorax sp. JS42: Ajs_1400
Entry
Ajs_1400          CDS       T00455                                 

Definition
(GenBank) putative secreted protein
Organism
ajs  Acidovorax sp. JS42
SSDB
Motif
Pfam: UPF0242 Macoilin DUF2353 Pex19 DUF4407 YabA
Other DBs
NCBI-ProteinID: ABM41615
UniProt: A1W5U0
Position
complement(1468011..1469441)
AA seq 476 aa
MRSNGLLKWLMIPVAILVLFVGIRLFSGGGSTAPPAEDNGAQLTPDEMKALGIEGDTPRD
TVATLVAQVKQLRTELQTALSDNKSQREENQRLRQRENSIDQRINSALESERSNLRRDQE
QAASARQQTEGLLADLQRRLDSIGGRGGGHADLPVGLGLQGGDEAGMEGGVRWVEPDDAK
PAEGRNGGRGASGGMSFPTSFGPAQSTLETTAETVANAGARAAGVKSAKPVYTVPTNSTL
MGSVAMTALIGRVPIDGTVNDPYPFKVLVGPDNLTANGIDIPDVAGAVFSGTASGDWTLS
CVRGQVRSITFVFHDGTIRTIPEDREGNQQDNQQQNSQSGGLGWISDPHGIPCVSGERRS
NAQQYLGSQALITAAGAGVASLIESDSGRMSYVGSDGSIGTVGITGQEAVGQILAGGVRD
MSAWVNKLYGQAFAAVYVQPGAKVAVHLEKPLAIDFDPEGRKVDHRAGESHALELE
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgcgcagtaacggcctgctcaagtggctgatgatccctgtcgccatcctggtgctgttc
gtcggtatccggctgttctcgggtggaggcagcacggcgccacccgcggaggacaacggc
gcccagctcacgcccgatgaaatgaaggctctcggcatcgagggcgataccccgcgcgac
accgtggcgaccttggtggcgcaggtgaagcagttgcgcaccgagcttcagaccgcgctc
tcggacaacaagtcccagcgtgaagagaaccagcggctgcgtcagcgcgaaaactccatc
gaccagcgcatcaactcggcgctcgaatccgagcggtccaacctgcgccgcgaccaggag
caggcggccagcgcgcgccagcagaccgaagggctgctcgccgacctgcagcggcgcctg
gacagcatcggcgggcgcggcggcggccatgcggacctgcccgtgggcttggggctgcag
ggcggcgacgaggccggcatggagggcggcgtgcggtgggtcgagccggacgacgcaaag
cccgccgaggggcgcaacggggggcgtggcgcgagcggcggcatgagcttccccacgagc
ttcggcccggcgcagagcacgctcgaaaccaccgcggaaaccgtggccaacgcgggcgcc
cgcgccgccggggtcaagagtgccaagccggtctataccgtgccgaccaactcgacgctg
atgggatcggtggcgatgacggccctgatcggccgcgtgccgatcgacggcacggtcaac
gatccctatccgttcaaagtcctggtcgggccggacaacctgaccgccaatggcatcgac
attcccgacgtggccggcgccgtgttcagcggcaccgcctcgggcgactggacgctgtcg
tgcgtgcgcggtcaggtgcgcagcatcacgttcgtcttccacgacggcacgatccgcacg
atccccgaagaccgcgagggcaaccagcaggacaaccaacagcagaactctcaaagtggg
ggcttgggctggatcagcgatccccacggcatcccgtgcgtcagcggcgagcggcgcagc
aacgcccagcaatacctcggctcgcaggccctgatcaccgcggccggtgccggtgtggcc
tcgctcatcgagagcgacagcggccgcatgtcctatgtcggctcggacggctccatcggc
accgtgggcatcaccggccaggaagcggtcggccagattctggcgggcggcgtgcgggac
atgtcggcctgggtcaacaagttgtacggccaggcattcgccgccgtctatgttcagccc
ggcgccaaggtggccgtccacctcgaaaagccgctcgccatcgacttcgatcccgaaggc
cgcaaggtcgatcaccgcgcaggagaaagccatgctctcgaacttgaatag

DBGET integrated database retrieval system