KEGG   Acidovorax sp. JS42: Ajs_1401Help
Entry
Ajs_1401          CDS       T00455                                 

Definition
(GenBank) putative secreted protein
Organism
ajs  Acidovorax sp. JS42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3438
Motif
Other DBs
NCBI-ProteinID: ABM41616
UniProt: A1W5F8
Position
complement(1469431..1470339)
Genome map
AA seq 302 aa AA seqDB search
MKHPVLALLGLLAVAAAPVAHAVEILRWERMPLAVPLKVGQERIVFIDRDVRVGVPAGVG
ERLRVQSAGGAVYLRASEPIEPTRLQLQDADTGALILLDIAAEPPKDGEAELEPVRIVEG
SSTPARYGDQAGGADDAPARAQAGARTARRETPVPVVLTRFAAQNLYAPLRTVEPLPGVM
RVNLPRDLDLDTLMPTLPVRAVALASWRLEDQWVTAVRLTNGSGGWITLDPRVLQGDFLT
ATFQHEALGPRGTPEDTTVLYLVTRGRGLAQSLLPAIHRFDPALHLPQPDGDENTKEARH
AQ
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaccctgtactcgcgctgctgggactgctggccgtggccgcggcacccgtcgcc
catgcagtggaaatcctgcgctgggagcgcatgccgctggcagtgccgctgaaggtcggt
caggaacgcatcgtgttcatcgaccgggacgtgcgcgtgggcgtgcccgcgggcgtgggc
gagcgcctccgcgtacagagcgcgggcggcgcggtgtacctgcgcgccagcgagccgatc
gagcccacgcggttgcaactgcaggacgccgacacgggcgcgctgatcctgctggacatc
gcggccgaaccacccaaggacggcgaggccgagctggagccggtgcgcatcgtcgagggc
agcagcactccagcgcgctacggcgatcaggcaggcggcgccgacgatgccccagcacgt
gcccaggcaggtgctcggaccgcgcggcgcgaaaccccggtccctgtcgtcctgacgcgc
ttcgccgcgcagaacctctacgcgccgttgcgcaccgtggagccgctgccgggcgtcatg
cgggtcaacctgccccgcgacctcgacctggacacactgatgccaacgctgcccgtgcgc
gcggtcgcgctcgcgtcgtggcgcctggaggaccagtgggtcacagccgtgcgcctgacc
aacggcagcggcggctggatcacgctcgacccgcgcgtgctgcaaggcgatttcctcacc
gccaccttccagcacgaggcgctgggcccgcgcggcacgcccgaggacacgaccgtcctg
tacctggtcacgcgcggccgcggcctcgcgcagtcgctgctgccggcgattcaccgcttc
gaccctgccctgcatctgccgcagccggacggcgacgagaacaccaaggaggcccgccat
gcgcagtaa

DBGET integrated database retrieval system