KEGG   Acidovorax sp. JS42: Ajs_1402Help
Entry
Ajs_1402          CDS       T00455                                 

Definition
(GenBank) putative secreted protein
Organism
ajs  Acidovorax sp. JS42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2895
Motif
Other DBs
NCBI-ProteinID: ABM41617
UniProt: A1W5F9
Position
complement(1470336..1471028)
Genome map
AA seq 230 aa AA seqDB search
MSRFKNEIAHLQAHIKTLRLGAGALVVVALVMGGGWWSAPRDLTIHVPPDLRSGSTRKWW
EVPPESVYAFTFYVFQTLNRWPTNGEEDYPRNLHTLSPYLTPSCQAFLRADYDYRRSTGE
LRQRVRGIYEIPGRGYGDDPTARVRTVSDRDWVVTLDITADEYYGAEQVKRALVRYPIKV
TRVDVDPARNPFGLALDCYDGAPQRISAPEPTRPAPSGLSPQAPQGGNTP
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcttcaagaacgagatcgcccacctgcaggcgcacatcaagaccttgcggctg
ggcgcgggcgcgctggtcgtcgttgccctggtcatgggcggcggctggtggagcgcgccg
cgcgacctgaccatccacgtcccgcccgacctgcgctctggcagtacccgcaagtggtgg
gaggtgccgcccgaatcggtctatgcgttcacgttctacgtgttccagacgttgaaccgc
tggccgaccaatggcgaagaggactacccgcgcaacctccacacgctctcgccgtacctc
accccatcctgccaggccttcctgcgggcggactacgactaccgccgctccaccggcgag
ctgcgccagcgcgtgcgcggcatctacgagattcccggccgcggctatggcgacgacccc
acggcacgcgtgcgcaccgtgtccgaccgcgactgggtggtgacgctggacatcacggcg
gacgagtactacggcgccgagcaggtcaagcgcgccctggtgcgctatccgatcaaggtc
acgcgggtggatgtcgatcccgcccgcaacccgttcggcctggcgctggactgctacgac
ggcgcgccccagcgcatcagtgcaccggagccgacgcgcccggcgccgagtggcctgtct
ccgcaagcgcctcaaggaggaaacaccccatga

DBGET integrated database retrieval system