KEGG   Acidovorax sp. JS42: Ajs_1403Help
Entry
Ajs_1403          CDS       T00455                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ajs  Acidovorax sp. JS42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3487 TraL
Motif
Other DBs
NCBI-ProteinID: ABM41618
UniProt: A1W5G0
Position
complement(1471025..1471423)
Genome map
AA seq 132 aa AA seqDB search
MSEQQHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLLVGAPLSWVFRTI
ALAPTFVVLGVALGVFIGGGILRRLKRGRPDTWLYRQLQWRIVTRHPLMAGWVGGHVLIS
RSGFWSTRRSMR
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcagcagcacgtccgtgcggacgggaccgtgacgttccttccgcaccggctc
aaccgccatcccgttgtcgtgcgcggcctcaccgccgatgaactctggatttgctgcggc
ctgtccggcgccgccggcctgctggtcggcgcgcccctgtcctgggtgttccgcacgatc
gcgctggcgccgacgttcgtcgtcctgggtgtggcgctcggcgtcttcatcggcggcggc
atcctgcgccgcctcaagcgtgggcgtcccgacacttggctgtatcgacaactgcaatgg
cgcatcgtcacgcgccatccgctgatggcaggctgggttggtggccatgtgctgatctcg
cgctcgggcttctggtccacccgcaggagcatgcgatga

DBGET integrated database retrieval system