KEGG   Acidovorax sp. JS42: Ajs_1406Help
Entry
Ajs_1406          CDS       T00455                                 

Definition
(GenBank) putative secreted protein
Organism
ajs  Acidovorax sp. JS42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Plasmid_RAQPRD
Motif
Other DBs
NCBI-ProteinID: ABM41621
UniProt: A1W5U6
Position
complement(1472041..1472421)
Genome map
AA seq 126 aa AA seqDB search
MLAPIWQRAAHRGVPIFLVTALLGQSPMALAESPAQRQELVAALRQLGALERSVADSAAH
APVQPGERYHFDYPRLLADLARVRAGIQAHLAPSRAQPRDPSELAGDYRAERAASPSPTA
TAEGKP
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgttggctccgatctggcagcgtgccgcgcatcgcggcgtgcccatctttctcgtgacg
gccctgctgggtcagtccccgatggcgttggccgaatcccccgcacagcgccaggagctg
gtcgccgcgctgcgccagctcggcgcgctggagcgctccgtcgccgacagcgccgcgcat
gcccccgtccagccgggcgagcgctaccacttcgactacccgcggctgctggctgacctg
gcgcgcgtgcgcgccggcatccaggcccatctcgcaccgtcgcgtgcccagccgcgcgat
ccctccgaactggccggcgactaccgcgccgagcgggccgcttcgccatcgccgacggcg
actgcggaaggcaagccatga

DBGET integrated database retrieval system