KEGG   Acidovorax sp. JS42: Ajs_1410
Entry
Ajs_1410          CDS       T00455                                 
Name
(GenBank) Lytic transglycosylase, catalytic
Organism
ajs  Acidovorax sp. JS42
SSDB
Motif
Pfam: SLT Glucosaminidase SLT_3
Other DBs
NCBI-ProteinID: ABM41625
Position
complement(1476008..1476598)
AA seq 196 aa
MAAPAVAMPLRALVLTAGLYAVAALAQEVPPPAYQLAAQRAGIPSTVLYAVALQESGIRR
NGRTVPWPWSLNVAGQSRRFATRADACAGLQQAMRSTPHTRIDAGLGQINLGYHQRRYAN
ACDLLDPYRNLATAAEILKEQHAPGEDWLLAIGRYHRPAGGEPAARYRRSVSRHLARVQG
ARPAAAALAARQETSP
NT seq 591 nt   +upstreamnt  +downstreamnt
atggcagcgccagccgtagccatgcccctgcgcgcactggtgctcactgccggcctgtat
gccgttgccgccctggcccaggaggttccgccaccggcctaccagcttgccgcccagcga
gcaggcatcccttcgacggtgctctacgccgtggccttgcaggagagcggcatccgccgc
aacggtcgcaccgtcccgtggccgtggtccctcaacgtcgccggccagtcgcgccgcttt
gccacgcgcgccgatgcctgcgcaggtctccagcaggcgatgcgctccacgccgcacacg
cgcatcgacgcgggcctgggccagatcaacctcggctatcaccagcggcgctacgccaat
gcgtgcgacttgctcgacccgtaccgcaacctcgccaccgctgccgagatcctgaaggaa
cagcacgcccccggcgaggactggttgctggcgatcggccgctaccaccgccccgcgggc
ggtgaacccgctgcccgctatcgccgtagcgtgtcccgccaccttgcccgtgtgcagggc
gcgcgcccagccgccgcggccctcgccgcgcgccaggagacctccccatga

DBGET integrated database retrieval system