KEGG   Acidovorax sp. JS42: Ajs_1413Help
Entry
Ajs_1413          CDS       T00455                                 

Definition
(GenBank) putative secreted protein
  KO
K02487  type IV pili sensor histidine kinase and response regulator
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ajs_1413
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ajs02022]
    Ajs_1413
   02035 Bacterial motility proteins [BR:ajs02035]
    Ajs_1413
Two-component system [BR:ajs02022]
 CheA family
  ChpA-ChpB/PilGH (chemosensory)
   Ajs_1413
Bacterial motility proteins [BR:ajs02035]
 Pilus system
  Twitching motility proteins
   Ajs_1413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABM41628
UniProt: A1W5V3
Position
complement(1477941..1478540)
Genome map
AA seq 199 aa AA seqDB search
MCPSPPWFHHPERRLLAGFLGLLWSVLAGGCATASAPVAPDTIEEVSAAPVPEAPEYIPV
VRYDRYTLVELAPTAAQRDLLLQTIDVSMPEDARATVGDGLRHVLKRSGYGLCRTAHAVI
ELYTLPLPAAHLHLGPMTLRDALLTLAGPAWELHADDRARQICFERPGDSMTADNVPAPP
ATEAVQTFPLVPEASEGQP
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtgcccctctcccccctggtttcaccatcccgaacgccgcctgctggcgggttttctc
ggcctgctttggtcggtgctggctggcggctgcgcgacggcgagcgcgccggtcgcgccc
gacaccatcgaggaagtctcggccgcgcccgtacccgaggcgcccgagtacatccccgtc
gtgcgctacgaccgctacaccctcgtggaactggcaccaacagcagcgcagcgcgacctg
ctgttgcagaccatcgacgtgtcgatgcccgaggatgcacgcgccacggtcggcgacggg
ctacggcatgtgctcaagcgcagcggttacggcttgtgccggacggcgcacgcggtgatc
gagctgtacaccctgccgctgccggcggcgcacctgcacctcggccccatgaccctgcgc
gatgcgctgctcaccctggctggtccggcctgggaactgcacgcggatgaccgcgcgcgg
caaatctgcttcgagcggcccggcgacagcatgaccgccgacaacgtacccgcgccgccc
gccaccgaggcggtgcagacgttcccgctggtgcccgaggcatcggaaggtcagccatga

DBGET integrated database retrieval system