KEGG   Acidovorax sp. JS42: Ajs_1466
Entry
Ajs_1466          CDS       T00455                                 

Definition
(GenBank) Isoprenylcysteine carboxyl methyltransferase
Organism
ajs  Acidovorax sp. JS42
SSDB
Motif
Pfam: PEMT ICMT ERG4_ERG24 YIF1 TerC DUF1295 DUF2852
Other DBs
NCBI-ProteinID: ABM41674
UniProt: A1W5Z9
Position
1523598..1524266
AA seq 222 aa
MNHTESAYGLWSLVIINSAIFIMFAFSFFKPATARDWRTFGAFAAFIVALFVEMYGFPLT
IYLLSGWLQTKFPNLDLLSHTSGHLWSTLLGEKGDPHFGVLHIASYVFLGFGFYLLSTAW
NVLYHAQRGQSLATTGPYARIRHPQYVAFVMILLGFLLQWPTLLTLAMFPVLLLMYRRLA
ITEENEMHKQFGATYDTYAQRTPRFIPRMGKAQSTTDSVSKR
NT seq 669 nt   +upstreamnt  +downstreamnt
atgaaccataccgaatccgcttatggcctgtggtcgctggtcatcatcaattcagcgatc
ttcatcatgtttgcgttcagctttttcaagcctgcgacggcacgtgactggaggacgttt
ggcgcatttgcagccttcatcgttgctttgttcgtggagatgtatggcttcccgttgacg
atttatctgctgtcgggctggctgcaaaccaagttccctaatctggatctgctctctcac
acatcgggtcacctgtggtctaccctcttgggcgaaaagggcgacccgcatttcggcgta
ctgcacatcgccagctacgtttttctgggctttggtttctacctgttgtccacagcgtgg
aatgtgctctaccacgctcagcgtggccaatcgcttgcaacaacaggcccctacgcgcgc
attcgccatccgcagtacgtggcttttgtgatgattctgctgggcttcctgctgcagtgg
cccaccttgctgaccttggccatgttccctgtcttgctcctgatgtaccgacgtctggca
atcaccgaagagaacgaaatgcacaaacagttcggtgcaacgtacgacacatacgcccag
cgcacaccccggtttatccctcgcatgggcaaggcccagtcgacgactgactcggtgtca
aaaagatga

DBGET integrated database retrieval system