KEGG   Acidovorax sp. JS42: Ajs_2069Help
Entry
Ajs_2069          CDS       T00455                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs00300  Lysine biosynthesis
ajs01100  Metabolic pathways
ajs01120  Microbial metabolism in diverse environments
ajs01230  Biosynthesis of amino acids
Module
ajs_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ajs00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Ajs_2069
Enzymes [BR:ajs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Ajs_2069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ABM42245
UniProt: A1W7M0
Position
2181459..2182634
Genome map
AA seq 391 aa AA seqDB search
MSPTLLLTEQLIARPSVTPDDAGCLDLLARRLAPLGFACERLDSGPENFRVSNLWSKRSA
ALSGQAQAATKTVVFAGHTDVVPTGPVEQWSSPPFTPTHRDGRLYGRGASDMKASIAAFV
VAVEEFLAATPDPRLDIALLLTSDEEGPSVDGTKVVIEQLRARGERLDWCIVGEPTSVEQ
TGDMIKNGRRGTLSGRLTVRGVQGHIAYPQLARNPIHQAVPALTELAATVWDMGNAFFPP
TSWQMSNIHGGTGATNVIPGQVVIDFNFRFSTESTAEGLQQRVHAVLDRHGLEYDLTWTL
GGQPFLTTPGELVQAVQQAIRAETGLETELSTTGGTSDGRFIAQICPQVIELGPPNASIH
KIDENVRLVDIEPLKNIYRRTLEHLNALAGA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccaccctgctactgaccgaacagctcatcgcccgcccctccgtcacgcccgac
gacgcgggctgcctggacttgctggcccggcgcctcgctcccttgggctttgcctgcgag
cgactggacagcgggcccgagaacttccgcgtcagcaatttgtggtcaaaacgcagtgca
gcgctctctggacaagcgcaagcagctaccaaaacagtagtattcgccggccacaccgac
gtggtgcccacgggccccgtggagcagtggagcagcccgccgttcacccccacacaccgg
gacggccgcctgtacggccgcggcgcgagtgacatgaaggcctcgatcgccgcattcgtt
gtcgcggtcgaggagttcctggccgccacgcccgacccgcgcctggatatcgcgctgctg
ctgaccagcgacgaggaaggcccctcggtggacggcaccaaggtggtcattgagcagttg
cgcgcgcgcggggagcggctggactggtgcatcgtgggcgagcctacctcggtcgagcag
accggcgacatgatcaagaacggccgccgcggcacgctgtccgggcggctcaccgtgcgg
ggggtgcagggccacatcgcctacccgcagctggcgcgcaaccccatccaccaggccgtg
cccgcgctcaccgagctcgccgccaccgtgtgggatatgggcaacgccttctttccgccg
accagctggcagatgagcaacatccacggcggcaccggtgcgaccaacgtgatccccggc
caggtggtgatcgacttcaacttccgcttcagcaccgaatcgaccgccgaagggctgcag
cagcgcgtgcatgcggtactggaccgccacggactggaatacgacctgacctggacgctg
ggcggccagcccttcctgaccacgccgggcgaactggtgcaggcggtgcagcaagccatc
cgcgccgagaccgggttggaaaccgagctgtccaccaccggcggcaccagcgacgggcgc
ttcattgcccagatttgcccccaggtgatcgagctgggcccgcccaacgccagcatccac
aagatcgacgagaacgtgcgcttggtcgacatcgagccgctcaagaacatctaccgccgc
acgctcgagcatctcaacgcactggcgggcgcatga

DBGET integrated database retrieval system