KEGG   Acidovorax sp. JS42: Ajs_2188Help
Entry
Ajs_2188          CDS       T00455                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ajs  Acidovorax sp. JS42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Golgin_A5 ZapB Mod_r YabA Macoilin UPF0242 APG6_N DUF3450 CENP-F_leu_zip SWIRM-assoc_1 TrbI DUF4456 YlqD
Motif
Other DBs
NCBI-ProteinID: ABM42353
UniProt: A1W7X8
Position
complement(2316755..2318188)
Genome map
AA seq 477 aa AA seqDB search
MKSNPLLKWLLIPMALLLVFVGIKLFSGAPGGQPAPKGAASTLTPEEMKALGIAGDTPRD
TVATLVAQVKQLRTELQSALGDNKQHKAENERLRARESAIDQRIQSALEGERSRLEQERN
QVASDRQQTQGLLQDLQRQLDGLSGKGGPSDLPVGLGLEEGDGQRFNRGVASTQWVEPDD
AKVDAKNSSKEPSFPLSFGPAQKSLSAAVESVADVGSRAVGASTKAVYTVPSNSTLMGSI
AMTALIGRVPIDGTVNDPYPFKVLIGPDNLTANGIDIPDVAGAVVSGTASGDWTLSCVRG
QIRSVTFVFQDGTIRTVPEDSSKGGSSGGNSGHNGASIQGGLGWISDPYGIPCVSGERRS
NAQQYLGSQALITAAGAGAASLIKSDNGSVAVVANSNGSLGTVGISGNEAMGRILAGGVR
DMADWVNKLYGQAFAAVYVQPGAKVAVHLEQPLDIDYDAKGRRVHHRTGEAHASDLD
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtaatccgttgctcaagtggctgctgatcccgatggcgctgctgctggtgttc
gtcggcatcaagctgttctccggcgcgcccggcggccagcccgctcccaagggcgcggcc
agtacgctcacgcccgaggagatgaaagccctgggcatcgctggcgacacgccgcgcgat
accgtcgccacgctggtggcccaggtgaagcagttgcgcaccgagctgcagagcgcgctg
ggcgacaacaagcagcacaaggccgagaacgagcgcctgcgcgcgcgggaaagcgcgatc
gaccaacgcatccagagcgcgctggaaggcgagcgcagccgcctggagcaggagcgcaat
caggtggccagcgacaggcagcagacccaggggctgctgcaggatctgcagcggcaactg
gacggcctttccggcaagggtggcccgtccgatctgcccgtcgggctggggctcgaagag
ggtgacggccagcgcttcaaccgcggcgtcgctagcacgcagtgggtcgagcccgacgat
gccaaggtcgacgccaagaacagcagcaaggagccgagctttcccctgagcttcgggccg
gcccagaaaagcctgtcggccgcagtggaatccgtcgccgacgtcggcagccgcgcggtg
ggcgcatccacgaaggctgtctacaccgtgccgtcgaactcgacgctcatggggtcgatt
gccatgacggcgctgatcgggcgcgtgccaatcgatggaaccgtcaacgatccctatccg
ttcaaggtgctgatcggcccggacaacctcacggccaacggcatcgacatccccgacgtg
gccggcgccgtggtcagcggcacggcctcgggcgactggacgctctcgtgcgtgcgcggg
caaatccgctcggtcacgttcgtgttccaggacggcaccatccgcacggtgccggaggac
agcagcaagggcggcagcagcggcggcaactcggggcacaacggcgccagcatccaaggc
ggtctgggctggatcagcgacccctacggcattccctgcgtcagcggcgagcggcgcagc
aacgcccagcagtacctgggcagccaggcgctcatcaccgcggccggcgccggcgcggcc
tcgctcatcaagtccgacaacggcagcgtggccgtggtcgccaacagcaacggctcgctg
ggcaccgtcggcatcagcggcaacgaagcgatgggccgcatcctcgcgggcggcgtgcgc
gacatggccgattgggtcaacaagctctacggccaggccttcgcggcggtctacgtgcag
ccgggcgccaaagtggccgtgcacctggagcagccgctcgacatcgactacgacgccaag
gggcgtcgggtccaccaccgcaccggagaagcccatgcctcggatctggattga

DBGET integrated database retrieval system