KEGG   Acidovorax sp. JS42: Ajs_2191Help
Entry
Ajs_2191          CDS       T00455                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ajs  Acidovorax sp. JS42
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3487 TraL PrgI LapA_dom
Motif
Other DBs
NCBI-ProteinID: ABM42356
UniProt: A1W7Y1
Position
complement(2319778..2320188)
Genome map
AA seq 136 aa AA seqDB search
MAVPSETPQDTLVTFLPHRLNRQPVVVRGLTADELWICTGLSAAAGFALGLPLAWLTHSI
AMVPTLIVAGIALGVFVGGGFLRAQKRGRPDTWLYRQLQWRLALRYPALAALLGGQRLIT
RSGYWTTRRNADRGAP
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcccttcggagaccccgcaagacacgctggtgaccttcctgccgcaccggctg
aaccgccagccggtggtcgtgcgcgggctgaccgccgacgagttgtggatctgcaccggc
ctgtcggccgcagccggattcgcgctcggcctgccgctggcctggctcacgcacagcatc
gccatggtgccgacgctgatcgtcgccggtatcgcgctgggcgtcttcgtcggcggcggc
ttcctgcgcgcgcagaagcgcggccggcccgacacctggctgtaccggcagctccagtgg
cggctggccctgcggtatccggcgctggcggcactcctgggcgggcagcgcctcatcacc
cgctcgggctactggacgacccggcgcaacgccgatcgaggtgcgccatga

DBGET integrated database retrieval system