KEGG   Acidovorax sp. JS42: Ajs_2207
Entry
Ajs_2207          CDS       T00455                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ajs  Acidovorax sp. JS42
SSDB
Motif
Pfam: DUF4400
Other DBs
NCBI-ProteinID: ABM42372
UniProt: A1W7Z7
Position
complement(2341585..2342334)
AA seq 249 aa
MSDPAVAAQRQQQRQQGLIAGLVTLPFRFFGVLCGALLLCILIECVGMHFFWPEQGWRHA
QGMLHYELDQLSTHFTRSALVQEPGRTAHRLVELGYDWLFVKSGLLDWIRDASAQAGAGS
HRPTKDFRYYIGLVYVNVESYLIAAAYTTLVFLVRLLVLCLTLPLFLMTAFVGLVDGLVR
RDIRRFGAGRESGFIYHRARASLIPLAVLPWVTYLALPVSVNPLLILLPSAALLGVAVCI
AAATFKKYL
NT seq 750 nt   +upstreamnt  +downstreamnt
atgagcgatccggccgtcgctgcccagcgccagcagcaacgacagcaggggctgatcgcc
ggcctggtcacgctgccgttccgcttcttcggcgtgctgtgcggcgcgctgctgctgtgc
atcctgatcgaatgcgtcggcatgcacttcttctggcccgagcagggctggcgccacgcg
cagggcatgctgcactacgagctggatcagctctccacgcatttcacgcgcagcgcgctg
gtgcaggagccggggcgcaccgcgcaccggctggtcgaactgggctacgactggctgttc
gtgaagagcggtctgctggactggatacgcgacgcctcggcgcaggccggcgccggcagc
catcgcccgaccaaggatttccgctactacatcggcttggtctacgtgaacgtggagagc
tacctgatcgcggcggcctacacgacgctggtcttcctcgtgcggctgctggtgctgtgc
ctgaccctgccgttgttcctgatgaccgccttcgtcggactggtggacggcctggtgcgc
cgggacatccgccgcttcggcgcgggacgcgaatcggggttcatctatcaccgcgccagg
gccagcctgatcccgctggccgtgctgccgtgggtgacttacctggcactgccggtcagc
gtgaacccgctgctgatcctgctgcccagcgccgcactgctcggcgtggcggtgtgcatc
gcggcggcgacgttcaagaagtacttgtga

DBGET integrated database retrieval system